eF-site ID 1ssk-A
PDB Code 1ssk
Chain A

click to enlarge
Title Structure of the N-terminal RNA-binding Domain of the SARS CoV Nucleocapsid Protein
Classification STRUCTURAL PROTEIN
Compound Nucleocapsid protein
Source Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus) (NCAP_CVHSA)
Sequence A:  MGSSHHHHHHSSGLVPRGSAMGLPNNTASWFTALTQHGKE
ELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMK
ELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTP
KDHIGTRNPNNNAATVLQLPQGTTLPKGFYAEGSRGGS
Description (1)  Nucleocapsid protein

Display surface

Download
Links