eF-site ID 1srg-AB PDB Code 1srg Chain A, B click to enlarge Title STRUCTURE-BASED DESIGN OF SYNTHETIC AZOBENZENE LIGANDS FOR STREPTAVIDIN Classification BIOTIN-BINDING PROTEIN Compound STREPTAVIDIN Source null (SAV_STRAV) Sequence A:  AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRY VLTGRYDSAPASGTALGWTVAWKNNYRNAHSATTWSGQYV GGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV B:  AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRY VLTGRYDSAPASGTALGWTVAWKNNYRNAHSATTWSGQYV GGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV Description Functional site 1) chain B residue 23 type sequence N description BINDING SITE FOR RESIDUE MHB A 300 source : AC1 2) chain B residue 27 type sequence S description BINDING SITE FOR RESIDUE MHB A 300 source : AC1 3) chain B residue 43 type sequence Y description BINDING SITE FOR RESIDUE MHB A 300 source : AC1 4) chain B residue 45 type sequence S description BINDING SITE FOR RESIDUE MHB A 300 source : AC1 5) chain B residue 47 type sequence V description BINDING SITE FOR RESIDUE MHB A 300 source : AC1 6) chain B residue 49 type sequence N description BINDING SITE FOR RESIDUE MHB A 300 source : AC1 7) chain B residue 50 type sequence A description BINDING SITE FOR RESIDUE MHB A 300 source : AC1 8) chain B residue 79 type sequence W description BINDING SITE FOR RESIDUE MHB A 300 source : AC1 9) chain B residue 86 type sequence A description BINDING SITE FOR RESIDUE MHB A 300 source : AC1 10) chain B residue 92 type sequence W description BINDING SITE FOR RESIDUE MHB A 300 source : AC1 11) chain B residue 108 type sequence W description BINDING SITE FOR RESIDUE MHB A 300 source : AC1 12) chain B residue 128 type sequence D description BINDING SITE FOR RESIDUE MHB A 300 source : AC1 13) chain A residue 23 type sequence N description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 14) chain A residue 27 type sequence S description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 15) chain A residue 43 type sequence Y description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 16) chain A residue 45 type sequence S description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 17) chain A residue 47 type sequence V description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 18) chain A residue 49 type sequence N description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 19) chain A residue 50 type sequence A description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 20) chain A residue 79 type sequence W description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 21) chain A residue 86 type sequence A description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 22) chain A residue 90 type sequence T description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 23) chain A residue 108 type sequence W description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 24) chain A residue 128 type sequence D description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 25) chain A residue 43 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI1 26) chain A residue 54 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI1 27) chain A residue 92 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI1 28) chain A residue 108 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI1 29) chain A residue 120 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI1 30) chain B residue 43 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI1 31) chain B residue 54 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI1 32) chain B residue 92 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI1 33) chain B residue 108 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI1 34) chain B residue 120 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI1 35) chain A residue 118-132 type prosite sequence NAWKSTLVGHDTFTK description AVIDIN_1 Avidin-like domain signature. NawKStlVGhDtFTK source prosite : PS00577

Display surface Download Links