eF-site ID 1srg-A PDB Code 1srg Chain A click to enlarge Title STRUCTURE-BASED DESIGN OF SYNTHETIC AZOBENZENE LIGANDS FOR STREPTAVIDIN Classification BIOTIN-BINDING PROTEIN Compound STREPTAVIDIN Source Streptomyces avidinii (SAV_STRAV) Sequence A:  AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRY VLTGRYDSAPASGTALGWTVAWKNNYRNAHSATTWSGQYV GGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV Description Functional site 1) chain A residue 23 type sequence N description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 2) chain A residue 27 type sequence S description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 3) chain A residue 43 type sequence Y description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 4) chain A residue 45 type sequence S description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 5) chain A residue 47 type sequence V description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 6) chain A residue 49 type sequence N description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 7) chain A residue 50 type sequence A description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 8) chain A residue 79 type sequence W description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 9) chain A residue 86 type sequence A description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 10) chain A residue 90 type sequence T description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 11) chain A residue 108 type sequence W description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 12) chain A residue 128 type sequence D description BINDING SITE FOR RESIDUE MHB B 300 source : AC2 13) chain A residue 43 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI1 14) chain A residue 54 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI1 15) chain A residue 92 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI1 16) chain A residue 108 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI1 17) chain A residue 120 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI1 18) chain A residue 118-132 type prosite sequence NAWKSTLVGHDTFTK description AVIDIN_1 Avidin-like domain signature. NawKStlVGhDtFTK source prosite : PS00577

Display surface Download Links