eF-site ID 1sn4-A
PDB Code 1sn4
Chain A

click to enlarge
Title STRUCTURE OF SCORPION NEUROTOXIN BMK M4
Classification TOXIN
Compound PROTEIN (NEUROTOXIN BMK M4)
Source ORGANISM_COMMON: Chinese scorpion; ORGANISM_SCIENTIFIC: Mesobuthus martensii;
Sequence A:  VRDAYIAKPENCVYHCAGNEGCNKLCTDNGAESGYCQWGG
RYGNACWCIKLPDDVPIRVPGKCH
Description (1)  NEUROTOXIN BMK M4


Functional site

1) chain A
residue 11
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ACT A 65
source : AC1

2) chain A
residue 12
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ACT A 65
source : AC1

3) chain A
residue 13
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ACT A 65
source : AC1

4) chain A
residue 18
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ACT A 65
source : AC1

5) chain A
residue 19
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ACT A 65
source : AC1

6) chain A
residue 38
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ACT A 65
source : AC1

7) chain A
residue 58
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ACT A 65
source : AC1

8) chain A
residue 63
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ACT A 65
source : AC1

9) chain A
residue 41
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ACT A 66
source : AC2

10) chain A
residue 50
type
ligand
sequence K
description BINDING SITE FOR RESIDUE ACT A 69
source : AC5

11) chain A
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ACT A 69
source : AC5

12) chain A
residue 17-20
type binding
ligand ACT: ACETATE ION
sequence AGNE
description ACETATE ION binding site
source pdb_hetatom : ACT_1sn4_A_65

13) chain A
residue 38
type binding
ligand ACT: ACETATE ION
sequence W
description ACETATE ION binding site
source pdb_hetatom : ACT_1sn4_A_65

14) chain A
residue 24
type binding
ligand ACT: ACETATE ION
sequence K
description ACETATE ION binding site
source pdb_hetatom : ACT_1sn4_A_68

15) chain A
residue 27
type binding
ligand ACT: ACETATE ION
sequence T
description ACETATE ION binding site
source pdb_hetatom : ACT_1sn4_A_68

16) chain A
residue 32
type binding
ligand ACT: ACETATE ION
sequence E
description ACETATE ION binding site
source pdb_hetatom : ACT_1sn4_A_68

17) chain A
residue 41
type binding
ligand ACT: ACETATE ION
sequence R
description ACETATE ION binding site
source pdb_hetatom : ACT_1sn4_A_66

18) chain A
residue 64
type binding
ligand ACT: ACETATE ION
sequence H
description ACETATE ION binding site
source pdb_hetatom : ACT_1sn4_A_69


Display surface

Download
Links