eF-site ID 1sn4-A PDB Code 1sn4 Chain A click to enlarge Title STRUCTURE OF SCORPION NEUROTOXIN BMK M4 Classification TOXIN Compound PROTEIN (NEUROTOXIN BMK M4) Source ORGANISM_COMMON: Chinese scorpion; ORGANISM_SCIENTIFIC: Mesobuthus martensii; Sequence A:  VRDAYIAKPENCVYHCAGNEGCNKLCTDNGAESGYCQWGG RYGNACWCIKLPDDVPIRVPGKCH Description Functional site 1) chain A residue 11 type sequence N description BINDING SITE FOR RESIDUE ACT A 65 source : AC1 2) chain A residue 12 type sequence C description BINDING SITE FOR RESIDUE ACT A 65 source : AC1 3) chain A residue 13 type sequence V description BINDING SITE FOR RESIDUE ACT A 65 source : AC1 4) chain A residue 18 type sequence G description BINDING SITE FOR RESIDUE ACT A 65 source : AC1 5) chain A residue 19 type sequence N description BINDING SITE FOR RESIDUE ACT A 65 source : AC1 6) chain A residue 38 type sequence W description BINDING SITE FOR RESIDUE ACT A 65 source : AC1 7) chain A residue 58 type sequence R description BINDING SITE FOR RESIDUE ACT A 65 source : AC1 8) chain A residue 63 type sequence C description BINDING SITE FOR RESIDUE ACT A 65 source : AC1 9) chain A residue 41 type sequence R description BINDING SITE FOR RESIDUE ACT A 66 source : AC2 10) chain A residue 50 type sequence K description BINDING SITE FOR RESIDUE ACT A 69 source : AC5 11) chain A residue 64 type sequence H description BINDING SITE FOR RESIDUE ACT A 69 source : AC5

Display surface Download Links