eF-site ID 1smp-A PDB Code 1smp Chain A click to enlarge Title CRYSTAL STRUCTURE OF A COMPLEX BETWEEN SERRATIA MARCESCENS METALLO-PROTEASE AND AN INHIBITOR FROM ERWINIA CHRYSANTHEMI Classification COMPLEX (METALLOPROTEASE/INHIBITOR) Compound SERRATIA METALLO PROTEINASE Source Serratia marcescens (INH_ERWCH) Sequence A:  TGYDAVDDLLHYHERGNGIQINGKDSFSNEQAGLFITREN QTWNGYKVFGQPVKLTFSFPDYKFSSTNVAGDTGLSKFSA EQQQQAKLSLQSWADVANITFTEVAAGQKANITFGNYSQD RPGHYDYGTQAYAFLPNTIWQGQDLGGQTWYNVNQSNVKH PATEDYGRQTFTHEIGHALGLSHPGDYNAGEGNPTYNDVT YAEDTRQFSLMSYWSETNTGGDNGGHYAAAPLLDDIAAIQ HLYGANLSTRTGDTVYGFNSNTGRDFLSTTSNSQKVIFAA WDAGGNDTFDFSGYTANQRINLNEKSFSDVGGLKGNVSIA AGVTIENAIGGSGNDVIVGNAANNVLKGGAGNDVLFGGGG ADELWGGAGKDIFVFSAASDSAPGASDWIRDFQKGIDKID LSFFNKEANSSDFIHFVDHFSGTAGEALLSYNASSNVTDL SVNIGGHQAPDFLVKIVGQVDVATDFIV Description (1)  SERRATIA METALLO PROTEINASE, ERWINIA CHRYSANTHEMI INHIBITOR Functional site 1) chain A residue 176 type sequence H description BINDING SITE FOR RESIDUE ZN A 472 source : AC1 2) chain A residue 180 type sequence H description BINDING SITE FOR RESIDUE ZN A 472 source : AC1 3) chain A residue 186 type sequence H description BINDING SITE FOR RESIDUE ZN A 472 source : AC1 4) chain A residue 253 type sequence R description BINDING SITE FOR RESIDUE CA A 473 source : AC2 5) chain A residue 255 type sequence G description BINDING SITE FOR RESIDUE CA A 473 source : AC2 6) chain A residue 257 type sequence T description BINDING SITE FOR RESIDUE CA A 473 source : AC2 7) chain A residue 285 type sequence D description BINDING SITE FOR RESIDUE CA A 473 source : AC2 8) chain A residue 287 type sequence G description BINDING SITE FOR RESIDUE CA A 473 source : AC2 9) chain A residue 290 type sequence D description BINDING SITE FOR RESIDUE CA A 473 source : AC2 10) chain A residue 288 type sequence G description BINDING SITE FOR RESIDUE CA A 474 source : AC3 11) chain A residue 290 type sequence D description BINDING SITE FOR RESIDUE CA A 474 source : AC3 12) chain A residue 327 type sequence T description BINDING SITE FOR RESIDUE CA A 474 source : AC3 13) chain A residue 329 type sequence E description BINDING SITE FOR RESIDUE CA A 474 source : AC3 14) chain A residue 334 type sequence G description BINDING SITE FOR RESIDUE CA A 475 source : AC4 15) chain A residue 336 type sequence G description BINDING SITE FOR RESIDUE CA A 475 source : AC4 16) chain A residue 338 type sequence D description BINDING SITE FOR RESIDUE CA A 475 source : AC4 17) chain A residue 351 type sequence G description BINDING SITE FOR RESIDUE CA A 475 source : AC4 18) chain A residue 353 type sequence A description BINDING SITE FOR RESIDUE CA A 475 source : AC4 19) chain A residue 356 type sequence D description BINDING SITE FOR RESIDUE CA A 475 source : AC4 20) chain A residue 343 type sequence N description BINDING SITE FOR RESIDUE CA A 476 source : AC5 21) chain A residue 345 type sequence A description BINDING SITE FOR RESIDUE CA A 476 source : AC5 22) chain A residue 347 type sequence N description BINDING SITE FOR RESIDUE CA A 476 source : AC5 23) chain A residue 360 type sequence G description BINDING SITE FOR RESIDUE CA A 476 source : AC5 24) chain A residue 362 type sequence G description BINDING SITE FOR RESIDUE CA A 476 source : AC5 25) chain A residue 365 type sequence D description BINDING SITE FOR RESIDUE CA A 476 source : AC5 26) chain A residue 352 type sequence G description BINDING SITE FOR RESIDUE CA A 477 source : AC6 27) chain A residue 354 type sequence G description BINDING SITE FOR RESIDUE CA A 477 source : AC6 28) chain A residue 356 type sequence D description BINDING SITE FOR RESIDUE CA A 477 source : AC6 29) chain A residue 369 type sequence G description BINDING SITE FOR RESIDUE CA A 477 source : AC6 30) chain A residue 371 type sequence A description BINDING SITE FOR RESIDUE CA A 477 source : AC6 31) chain A residue 374 type sequence D description BINDING SITE FOR RESIDUE CA A 477 source : AC6 32) chain A residue 361 type sequence G description BINDING SITE FOR RESIDUE CA A 478 source : AC7 33) chain A residue 362 type sequence G description BINDING SITE FOR RESIDUE CA A 478 source : AC7 34) chain A residue 363 type sequence G description BINDING SITE FOR RESIDUE CA A 478 source : AC7 35) chain A residue 365 type sequence D description BINDING SITE FOR RESIDUE CA A 478 source : AC7 36) chain A residue 383 type sequence D description BINDING SITE FOR RESIDUE CA A 478 source : AC7 37) chain A residue 390 type sequence D description BINDING SITE FOR RESIDUE CA A 478 source : AC7 38) chain A residue 370 type sequence G description BINDING SITE FOR RESIDUE CA A 479 source : AC8 39) chain A residue 372 type sequence G description BINDING SITE FOR RESIDUE CA A 479 source : AC8 40) chain A residue 374 type sequence D description BINDING SITE FOR RESIDUE CA A 479 source : AC8 41) chain A residue 396 type sequence Q description BINDING SITE FOR RESIDUE CA A 479 source : AC8 42) chain A residue 400 type sequence D description BINDING SITE FOR RESIDUE CA A 479 source : AC8 43) chain A residue 176 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 44) chain A residue 288 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 45) chain A residue 290 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 46) chain A residue 327 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI2 47) chain A residue 329 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 48) chain A residue 334 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 49) chain A residue 336 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 50) chain A residue 338 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 51) chain A residue 343 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 52) chain A residue 345 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI2 53) chain A residue 347 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 54) chain A residue 180 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 55) chain A residue 351 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 56) chain A residue 352 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 57) chain A residue 353 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI2 58) chain A residue 354 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 59) chain A residue 356 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 60) chain A residue 360 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 61) chain A residue 361 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 62) chain A residue 362 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 63) chain A residue 363 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 64) chain A residue 365 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 65) chain A residue 186 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI2 66) chain A residue 369 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 67) chain A residue 370 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 68) chain A residue 371 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI2 69) chain A residue 372 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 70) chain A residue 374 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 71) chain A residue 383 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 72) chain A residue 390 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 73) chain A residue 400 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 74) chain A residue 216 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 75) chain A residue 253 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 76) chain A residue 255 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 77) chain A residue 257 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI2 78) chain A residue 285 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 79) chain A residue 287 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 80) chain A residue 177 type ACT_SITE sequence E description source Swiss-Prot : SWS_FT_FI1 81) chain A residue 173-182 type prosite sequence TFTHEIGHAL description ZINC_PROTEASE Neutral zinc metallopeptidases, zinc-binding region signature. TFTHEIGHAL source prosite : PS00142 82) chain A residue 356-374 type prosite sequence DVLFGGGGADELWGGAGKD description HEMOLYSIN_CALCIUM Hemolysin-type calcium-binding region signature. DvLfgggGaDeLwGGagkD source prosite : PS00330

Display surface Download Links