eF-site ID 1sl7-A PDB Code 1sl7 Chain A click to enlarge Title Crystal structure of calcium-loaded apo-obelin from Obelia longissima Classification LUMINESCENT PROTEIN Compound Obelin Source null (OBL_OBELO) Sequence A:  TDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDI CAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLD GWKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTI TLDEWKAYGKISGISPSQEDCEATFRHCDLDDSGDLDVDE MTRQHLGFWYTLD Description Functional site 1) chain A residue 159 type sequence D description BINDING SITE FOR RESIDUE CA A 301 source : AC1 2) chain A residue 161 type sequence D description BINDING SITE FOR RESIDUE CA A 301 source : AC1 3) chain A residue 163 type sequence S description BINDING SITE FOR RESIDUE CA A 301 source : AC1 4) chain A residue 165 type sequence D description BINDING SITE FOR RESIDUE CA A 301 source : AC1 5) chain A residue 170 type sequence E description BINDING SITE FOR RESIDUE CA A 301 source : AC1 6) chain A residue 30 type sequence D description BINDING SITE FOR RESIDUE CA A 302 source : AC2 7) chain A residue 32 type sequence N description BINDING SITE FOR RESIDUE CA A 302 source : AC2 8) chain A residue 34 type sequence N description BINDING SITE FOR RESIDUE CA A 302 source : AC2 9) chain A residue 36 type sequence K description BINDING SITE FOR RESIDUE CA A 302 source : AC2 10) chain A residue 41 type sequence E description BINDING SITE FOR RESIDUE CA A 302 source : AC2 11) chain A residue 123 type sequence D description BINDING SITE FOR RESIDUE CA A 303 source : AC3 12) chain A residue 125 type sequence D description BINDING SITE FOR RESIDUE CA A 303 source : AC3 13) chain A residue 127 type sequence S description BINDING SITE FOR RESIDUE CA A 303 source : AC3 14) chain A residue 129 type sequence T description BINDING SITE FOR RESIDUE CA A 303 source : AC3 15) chain A residue 134 type sequence E description BINDING SITE FOR RESIDUE CA A 303 source : AC3 16) chain A residue 22 type catalytic sequence H description 768 source MCSA : MCSA1 17) chain A residue 92 type catalytic sequence W description 768 source MCSA : MCSA1 18) chain A residue 138 type catalytic sequence Y description 768 source MCSA : MCSA1 19) chain A residue 175 type catalytic sequence H description 768 source MCSA : MCSA1 20) chain A residue 30-42 type prosite sequence DINGNGKITLDEI description EF_HAND_1 EF-hand calcium-binding domain. DINGNGKITldEI source prosite : PS00018 21) chain A residue 123-135 type prosite sequence DKDGSGTITLDEW description EF_HAND_1 EF-hand calcium-binding domain. DINGNGKITldEI source prosite : PS00018 22) chain A residue 159-171 type prosite sequence DLDDSGDLDVDEM description EF_HAND_1 EF-hand calcium-binding domain. DINGNGKITldEI source prosite : PS00018 23) chain A residue 32 type BINDING sequence N description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 34 type BINDING sequence N description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 36 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 41 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 30 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 134 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 159 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 161 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 31) chain A residue 163 type BINDING sequence S description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 32) chain A residue 165 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 170 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 34) chain A residue 123 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 35) chain A residue 125 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 36) chain A residue 127 type BINDING sequence S description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 37) chain A residue 129 type BINDING sequence T description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links