eF-site ID 1skm-A PDB Code 1skm Chain A click to enlarge Title HhaI methyltransferase in complex with DNA containing an abasic south carbocyclic sugar at its target site Classification TRANSFERASE/DNA Compound 5'-D(*TP*CP*CP*AP*TP*GP*CP*GP*CP*TP*GP*AP*C)-3' Source null (1SKM) Sequence A:  MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNE WDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFP CQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMEN VKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIP QKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDS EVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGER IYSTRGIAITLSAYGGGIFAKTGGYLVNGKTRKLHPRECA RVMGYPDSYKVHPSTSQAYKQFGNSVVINVLQYIAYNIGS SLNFKPY Description Functional site 1) chain A residue 18 type sequence F description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 2) chain A residue 19 type sequence A description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 3) chain A residue 21 type sequence L description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 4) chain A residue 22 type sequence G description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 5) chain A residue 23 type sequence G description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 6) chain A residue 39 type sequence N description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 7) chain A residue 40 type sequence E description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 8) chain A residue 41 type sequence W description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 9) chain A residue 42 type sequence D description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 10) chain A residue 60 type sequence D description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 11) chain A residue 61 type sequence I description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 12) chain A residue 78 type sequence G description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 13) chain A residue 80 type sequence P description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 14) chain A residue 285 type sequence Y description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 15) chain A residue 304 type sequence N description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 16) chain A residue 305 type sequence S description BINDING SITE FOR RESIDUE SAH A 328 source : AC1 17) chain A residue 73-85 type prosite sequence DILCAGFPCQAFS description C5_MTASE_1 C-5 cytosine-specific DNA methylases active site. DiLcaGfPCqAFS source prosite : PS00094 18) chain A residue 81 type catalytic sequence C description 293 source MCSA : MCSA1 19) chain A residue 119 type catalytic sequence E description 293 source MCSA : MCSA1 20) chain A residue 163 type catalytic sequence R description 293 source MCSA : MCSA1 21) chain A residue 165 type catalytic sequence R description 293 source MCSA : MCSA1 22) chain A residue 300-318 type prosite sequence KQFGNSVVINVLQYIAYNI description C5_MTASE_2 C-5 cytosine-specific DNA methylases C-terminal signature. KqfGNSVvInVlqyIaynI source prosite : PS00095 23) chain A residue 81 type ACT_SITE sequence C description ACT_SITE => ECO:0000305|PubMed:7899082 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links