eF-site ID 1siz-A PDB Code 1siz Chain A click to enlarge Title Crystal structure of the [Fe3S4]-ferredoxin from the hyperthermophilic archaeon Pyrococcus furiosus Classification ELECTRON TRANSPORT Compound Ferredoxin Source Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (FER_PYRFU) Sequence A:  AWKVSVDQDTCIGDAICASLCPDVFEMNDEGKAQPKVEVI EDEELYNCAKEAMEACPVSAITIEEA Description Functional site 1) chain A residue 12 type sequence I description BINDING SITE FOR RESIDUE 3CO C 75 source : AC2 2) chain A residue 11 type sequence C description BINDING SITE FOR RESIDUE F3S A 70 source : AC3 3) chain A residue 12 type sequence I description BINDING SITE FOR RESIDUE F3S A 70 source : AC3 4) chain A residue 14 type sequence D description BINDING SITE FOR RESIDUE F3S A 70 source : AC3 5) chain A residue 15 type sequence A description BINDING SITE FOR RESIDUE F3S A 70 source : AC3 6) chain A residue 16 type sequence I description BINDING SITE FOR RESIDUE F3S A 70 source : AC3 7) chain A residue 17 type sequence C description BINDING SITE FOR RESIDUE F3S A 70 source : AC3 8) chain A residue 33 type sequence A description BINDING SITE FOR RESIDUE F3S A 70 source : AC3 9) chain A residue 56 type sequence C description BINDING SITE FOR RESIDUE F3S A 70 source : AC3 10) chain A residue 12 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI1 11) chain A residue 15 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI1 12) chain A residue 18 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI1 13) chain A residue 57 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links