eF-site ID 1sie-F PDB Code 1sie Chain F click to enlarge Title MURINE POLYOMAVIRUS COMPLEXED WITH A DISIALYLATED OLIGOSACCHARIDE Classification VIRUS Compound POLYOMAVIRUS COAT PROTEIN VP1 Source ORGANISM_SCIENTIFIC: Mouse polyomavirus (strain p16 small-plaque); Sequence F:  ACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPRM GQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLPT WSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLLD VHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQGL VTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLD KDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFTN TLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDVH HWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQVQ GQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVD Description (1)  POLYOMAVIRUS COAT PROTEIN VP1 Functional site 1) chain F residue 72 type ligand sequence Y description BINDING SITE FOR RESIDUE SIA F 384 source : CC3 2) chain F residue 77 type ligand sequence R description BINDING SITE FOR RESIDUE SIA F 384 source : CC3 3) chain F residue 78 type ligand sequence G description BINDING SITE FOR RESIDUE SIA F 384 source : CC3 4) chain F residue 291 type ligand sequence T description BINDING SITE FOR RESIDUE SIA F 384 source : CC3 5) chain F residue 296 type ligand sequence V description BINDING SITE FOR RESIDUE SIA F 384 source : CC3 6) chain F residue 298 type ligand sequence H description BINDING SITE FOR RESIDUE SIA F 384 source : CC3 7) chain F residue 78 type ligand sequence G description BINDING SITE FOR RESIDUE GAL F 385 source : CC4 8) chain F residue 79 type ligand sequence I description BINDING SITE FOR RESIDUE GAL F 385 source : CC4 9) chain F residue 93 type ligand sequence N description BINDING SITE FOR RESIDUE GAL F 385 source : CC4 10) chain F residue 89 type ligand sequence S description BINDING SITE FOR RESIDUE SIA F 387 source : CC6 11) chain F residue 72 type binding ligand SIA: O-SIALIC ACID sequence Y description O-SIALIC ACID binding site source pdb_hetatom : SIA_1sie_F_384 12) chain F residue 77-78 type binding ligand SIA: O-SIALIC ACID sequence RG description O-SIALIC ACID binding site source pdb_hetatom : SIA_1sie_F_384 13) chain F residue 291 type binding ligand SIA: O-SIALIC ACID sequence T description O-SIALIC ACID binding site source pdb_hetatom : SIA_1sie_F_384 14) chain F residue 293 type binding ligand SIA: O-SIALIC ACID sequence N description O-SIALIC ACID binding site source pdb_hetatom : SIA_1sie_F_384 15) chain F residue 296 type binding ligand SIA: O-SIALIC ACID sequence V description O-SIALIC ACID binding site source pdb_hetatom : SIA_1sie_F_384 16) chain F residue 298 type binding ligand SIA: O-SIALIC ACID sequence H description O-SIALIC ACID binding site source pdb_hetatom : SIA_1sie_F_384 17) chain F residue 77-80 type binding ligand GAL: BETA-D-GALACTOSE sequence RGIN description BETA-D-GALACTOSE binding site source pdb_hetatom : GAL_1sie_F_385 18) chain F residue 93-94 type binding ligand GAL: BETA-D-GALACTOSE sequence NT description BETA-D-GALACTOSE binding site source pdb_hetatom : GAL_1sie_F_385 19) chain F residue 296 type binding ligand GAL: BETA-D-GALACTOSE sequence V description BETA-D-GALACTOSE binding site source pdb_hetatom : GAL_1sie_F_385 20) chain F residue 87 type binding ligand SIA: O-SIALIC ACID sequence E description O-SIALIC ACID binding site source pdb_hetatom : SIA_1sie_F_387 21) chain F residue 89 type binding ligand SIA: O-SIALIC ACID sequence S description O-SIALIC ACID binding site source pdb_hetatom : SIA_1sie_F_387 22) chain F residue 186 type binding ligand SIA: O-SIALIC ACID sequence K description O-SIALIC ACID binding site source pdb_hetatom : SIA_1sie_F_387

Display surface Download Links