eF-site ID 1sie-F
PDB Code 1sie
Chain F

click to enlarge
Title MURINE POLYOMAVIRUS COMPLEXED WITH A DISIALYLATED OLIGOSACCHARIDE
Classification VIRUS
Compound POLYOMAVIRUS COAT PROTEIN VP1
Source ORGANISM_SCIENTIFIC: Mouse polyomavirus (strain p16 small-plaque);
Sequence F:  ACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPRM
GQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLPT
WSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLLD
VHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQGL
VTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLD
KDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFTN
TLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDVH
HWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQVQ
GQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVD
Description (1)  POLYOMAVIRUS COAT PROTEIN VP1


Functional site

1) chain F
residue 72
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SIA F 384
source : CC3

2) chain F
residue 77
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SIA F 384
source : CC3

3) chain F
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SIA F 384
source : CC3

4) chain F
residue 291
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SIA F 384
source : CC3

5) chain F
residue 296
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SIA F 384
source : CC3

6) chain F
residue 298
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SIA F 384
source : CC3

7) chain F
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GAL F 385
source : CC4

8) chain F
residue 79
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GAL F 385
source : CC4

9) chain F
residue 93
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GAL F 385
source : CC4

10) chain F
residue 89
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SIA F 387
source : CC6

11) chain F
residue 72
type binding
ligand SIA: O-SIALIC ACID
sequence Y
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_384

12) chain F
residue 77-78
type binding
ligand SIA: O-SIALIC ACID
sequence RG
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_384

13) chain F
residue 291
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_384

14) chain F
residue 293
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_384

15) chain F
residue 296
type binding
ligand SIA: O-SIALIC ACID
sequence V
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_384

16) chain F
residue 298
type binding
ligand SIA: O-SIALIC ACID
sequence H
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_384

17) chain F
residue 77-80
type binding
ligand GAL: BETA-D-GALACTOSE
sequence RGIN
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_F_385

18) chain F
residue 93-94
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_F_385

19) chain F
residue 296
type binding
ligand GAL: BETA-D-GALACTOSE
sequence V
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_F_385

20) chain F
residue 87
type binding
ligand SIA: O-SIALIC ACID
sequence E
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_387

21) chain F
residue 89
type binding
ligand SIA: O-SIALIC ACID
sequence S
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_387

22) chain F
residue 186
type binding
ligand SIA: O-SIALIC ACID
sequence K
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_387


Display surface

Download
Links