eF-site ID 1sie-F
PDB Code 1sie
Chain F
Title MURINE POLYOMAVIRUS COMPLEXED WITH A DISIALYLATED OLIGOSACCHARIDE
Classification VIRUS
Compound POLYOMAVIRUS COAT PROTEIN VP1
Source ORGANISM_SCIENTIFIC: Mouse polyomavirus (strain p16 small-plaque);
Sequence F:  ACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPRM
GQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLPT
WSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLLD
VHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQGL
VTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLD
KDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFTN
TLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDVH
HWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQVQ
GQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVD
Description (1)  POLYOMAVIRUS COAT PROTEIN VP1

Display surface

Download
Links