eF-site ID 1sie-E
PDB Code 1sie
Chain E

click to enlarge
Title MURINE POLYOMAVIRUS COMPLEXED WITH A DISIALYLATED OLIGOSACCHARIDE
Classification VIRUS
Compound POLYOMAVIRUS COAT PROTEIN VP1
Source ORGANISM_SCIENTIFIC: Mouse polyomavirus (strain p16 small-plaque);
Sequence E:  KACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPR
MGQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLP
TWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLL
DVHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQG
LVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKL
DKDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFT
NTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDV
HHWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQV
QGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVDRFGKT
KTVFPGN
Description (1)  POLYOMAVIRUS COAT PROTEIN VP1


Functional site

1) chain E
residue 72
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SIA E 384
source : BC8

2) chain E
residue 77
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SIA E 384
source : BC8

3) chain E
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SIA E 384
source : BC8

4) chain E
residue 291
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SIA E 384
source : BC8

5) chain E
residue 298
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SIA E 384
source : BC8

6) chain E
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GAL E 385
source : BC9

7) chain E
residue 79
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GAL E 385
source : BC9

8) chain E
residue 93
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GAL E 385
source : BC9

9) chain E
residue 89
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SIA E 387
source : CC2

10) chain E
residue 72
type binding
ligand SIA: O-SIALIC ACID
sequence Y
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

11) chain E
residue 77-78
type binding
ligand SIA: O-SIALIC ACID
sequence RG
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

12) chain E
residue 289
type binding
ligand SIA: O-SIALIC ACID
sequence R
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

13) chain E
residue 291
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

14) chain E
residue 293
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

15) chain E
residue 296
type binding
ligand SIA: O-SIALIC ACID
sequence V
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

16) chain E
residue 298
type binding
ligand SIA: O-SIALIC ACID
sequence H
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

17) chain E
residue 85
type binding
ligand SIA: O-SIALIC ACID
sequence D
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_D_384

18) chain E
residue 77-80
type binding
ligand GAL: BETA-D-GALACTOSE
sequence RGIN
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_E_385

19) chain E
residue 93-94
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_E_385

20) chain E
residue 296
type binding
ligand GAL: BETA-D-GALACTOSE
sequence V
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_E_385

21) chain E
residue 80
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_387

22) chain E
residue 87
type binding
ligand SIA: O-SIALIC ACID
sequence E
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_387

23) chain E
residue 89
type binding
ligand SIA: O-SIALIC ACID
sequence S
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_387

24) chain E
residue 186
type binding
ligand SIA: O-SIALIC ACID
sequence K
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_387


Display surface

Download
Links