eF-site ID 1sie-B
PDB Code 1sie
Chain B

click to enlarge
Title MURINE POLYOMAVIRUS COMPLEXED WITH A DISIALYLATED OLIGOSACCHARIDE
Classification VIRUS
Compound POLYOMAVIRUS COAT PROTEIN VP1
Source ORGANISM_SCIENTIFIC: Mouse polyomavirus (strain p16 small-plaque);
Sequence B:  KACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPR
MGQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLP
TWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLL
DVHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQG
LVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKL
DKDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFT
NTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDV
HHWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQV
QGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVDRFGKT
KTVFPGN
Description (1)  POLYOMAVIRUS COAT PROTEIN VP1


Functional site

1) chain B
residue 72
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SIA B 384
source : AC5

2) chain B
residue 77
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SIA B 384
source : AC5

3) chain B
residue 291
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SIA B 384
source : AC5

4) chain B
residue 296
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SIA B 384
source : AC5

5) chain B
residue 298
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SIA B 384
source : AC5

6) chain B
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GAL B 385
source : AC6

7) chain B
residue 79
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GAL B 385
source : AC6

8) chain B
residue 93
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GAL B 385
source : AC6

9) chain B
residue 85
type binding
ligand SIA: O-SIALIC ACID
sequence D
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_A_384

10) chain B
residue 72
type binding
ligand SIA: O-SIALIC ACID
sequence Y
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_384

11) chain B
residue 77-78
type binding
ligand SIA: O-SIALIC ACID
sequence RG
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_384

12) chain B
residue 291
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_384

13) chain B
residue 293
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_384

14) chain B
residue 296
type binding
ligand SIA: O-SIALIC ACID
sequence V
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_384

15) chain B
residue 298
type binding
ligand SIA: O-SIALIC ACID
sequence H
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_384

16) chain B
residue 77-80
type binding
ligand GAL: BETA-D-GALACTOSE
sequence RGIN
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_B_385

17) chain B
residue 91
type binding
ligand GAL: BETA-D-GALACTOSE
sequence G
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_B_385

18) chain B
residue 93-94
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_B_385

19) chain B
residue 296
type binding
ligand GAL: BETA-D-GALACTOSE
sequence V
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_B_385

20) chain B
residue 80
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_387

21) chain B
residue 87
type binding
ligand SIA: O-SIALIC ACID
sequence E
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_387

22) chain B
residue 89
type binding
ligand SIA: O-SIALIC ACID
sequence S
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_387

23) chain B
residue 91
type binding
ligand SIA: O-SIALIC ACID
sequence G
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_387


Display surface

Download
Links