eF-site ID 1sie-ABCDEF
PDB Code 1sie
Chain A, B, C, D, E, F

click to enlarge
Title MURINE POLYOMAVIRUS COMPLEXED WITH A DISIALYLATED OLIGOSACCHARIDE
Classification VIRUS
Compound POLYOMAVIRUS COAT PROTEIN VP1
Source ORGANISM_SCIENTIFIC: Mouse polyomavirus (strain p16 small-plaque);
Sequence A:  KACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPR
MGQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLP
TWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLL
DVHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQG
LVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKL
DKDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFT
NTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDV
HHWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQV
QGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVDRFGKT
KTVFPG
B:  KACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPR
MGQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLP
TWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLL
DVHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQG
LVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKL
DKDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFT
NTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDV
HHWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQV
QGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVDRFGKT
KTVFPGN
C:  KACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPR
MGQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLP
TWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLL
DVHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQG
LVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKL
DKDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFT
NTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDV
HHWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQV
QGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVDRF
D:  KACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPR
MGQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLP
TWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLL
DVHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQG
LVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKL
DKDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFT
NTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDV
HHWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQV
QGQPMEGENTQVEEVRVYDG
E:  KACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPR
MGQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLP
TWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLL
DVHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQG
LVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKL
DKDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFT
NTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDV
HHWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQV
QGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVDRFGKT
KTVFPGN
F:  ACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPRM
GQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLPT
WSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLLD
VHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQGL
VTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLD
KDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFTN
TLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDVH
HWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQVQ
GQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVD
Description (1)  POLYOMAVIRUS COAT PROTEIN VP1


Functional site

1) chain A
residue 72
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SIA A 384
source : AC1

2) chain A
residue 77
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SIA A 384
source : AC1

3) chain A
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SIA A 384
source : AC1

4) chain A
residue 291
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SIA A 384
source : AC1

5) chain A
residue 296
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SIA A 384
source : AC1

6) chain A
residue 298
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SIA A 384
source : AC1

7) chain A
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GAL A 385
source : AC2

8) chain A
residue 93
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GAL A 385
source : AC2

9) chain A
residue 89
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SIA A 387
source : AC4

10) chain A
residue 186
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SIA A 387
source : AC4

11) chain B
residue 72
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SIA B 384
source : AC5

12) chain B
residue 77
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SIA B 384
source : AC5

13) chain B
residue 291
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SIA B 384
source : AC5

14) chain B
residue 296
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SIA B 384
source : AC5

15) chain B
residue 298
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SIA B 384
source : AC5

16) chain B
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GAL B 385
source : AC6

17) chain B
residue 79
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GAL B 385
source : AC6

18) chain B
residue 93
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GAL B 385
source : AC6

19) chain C
residue 72
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SIA C 384
source : AC9

20) chain C
residue 77
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SIA C 384
source : AC9

21) chain C
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SIA C 384
source : AC9

22) chain C
residue 298
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SIA C 384
source : AC9

23) chain C
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GAL C 385
source : BC1

24) chain D
residue 72
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SIA D 384
source : BC4

25) chain D
residue 77
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SIA D 384
source : BC4

26) chain D
residue 296
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SIA D 384
source : BC4

27) chain D
residue 298
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SIA D 384
source : BC4

28) chain D
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GAL D 385
source : BC5

29) chain D
residue 93
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GAL D 385
source : BC5

30) chain E
residue 72
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SIA E 384
source : BC8

31) chain E
residue 77
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SIA E 384
source : BC8

32) chain E
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SIA E 384
source : BC8

33) chain E
residue 291
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SIA E 384
source : BC8

34) chain E
residue 298
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SIA E 384
source : BC8

35) chain E
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GAL E 385
source : BC9

36) chain E
residue 79
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GAL E 385
source : BC9

37) chain E
residue 93
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GAL E 385
source : BC9

38) chain E
residue 89
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SIA E 387
source : CC2

39) chain F
residue 72
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SIA F 384
source : CC3

40) chain F
residue 77
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SIA F 384
source : CC3

41) chain F
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SIA F 384
source : CC3

42) chain F
residue 291
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SIA F 384
source : CC3

43) chain F
residue 296
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SIA F 384
source : CC3

44) chain F
residue 298
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SIA F 384
source : CC3

45) chain F
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GAL F 385
source : CC4

46) chain F
residue 79
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GAL F 385
source : CC4

47) chain F
residue 93
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GAL F 385
source : CC4

48) chain F
residue 89
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SIA F 387
source : CC6

49) chain A
residue 72
type binding
ligand SIA: O-SIALIC ACID
sequence Y
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_A_384

50) chain A
residue 77-78
type binding
ligand SIA: O-SIALIC ACID
sequence RG
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_A_384

51) chain A
residue 291
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_A_384

52) chain A
residue 293
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_A_384

53) chain A
residue 296
type binding
ligand SIA: O-SIALIC ACID
sequence V
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_A_384

54) chain A
residue 298
type binding
ligand SIA: O-SIALIC ACID
sequence H
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_A_384

55) chain B
residue 85
type binding
ligand SIA: O-SIALIC ACID
sequence D
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_A_384

56) chain A
residue 77-80
type binding
ligand GAL: BETA-D-GALACTOSE
sequence RGIN
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_A_385

57) chain A
residue 91
type binding
ligand GAL: BETA-D-GALACTOSE
sequence G
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_A_385

58) chain A
residue 93-94
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_A_385

59) chain A
residue 296
type binding
ligand GAL: BETA-D-GALACTOSE
sequence V
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_A_385

60) chain A
residue 80
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_A_387

61) chain A
residue 87
type binding
ligand SIA: O-SIALIC ACID
sequence E
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_A_387

62) chain A
residue 89
type binding
ligand SIA: O-SIALIC ACID
sequence S
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_A_387

63) chain A
residue 186
type binding
ligand SIA: O-SIALIC ACID
sequence K
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_A_387

64) chain A
residue 85
type binding
ligand SIA: O-SIALIC ACID
sequence D
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

65) chain E
residue 72
type binding
ligand SIA: O-SIALIC ACID
sequence Y
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

66) chain E
residue 77-78
type binding
ligand SIA: O-SIALIC ACID
sequence RG
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

67) chain E
residue 289
type binding
ligand SIA: O-SIALIC ACID
sequence R
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

68) chain E
residue 291
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

69) chain E
residue 293
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

70) chain E
residue 296
type binding
ligand SIA: O-SIALIC ACID
sequence V
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

71) chain E
residue 298
type binding
ligand SIA: O-SIALIC ACID
sequence H
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_384

72) chain B
residue 72
type binding
ligand SIA: O-SIALIC ACID
sequence Y
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_384

73) chain B
residue 77-78
type binding
ligand SIA: O-SIALIC ACID
sequence RG
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_384

74) chain B
residue 291
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_384

75) chain B
residue 293
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_384

76) chain B
residue 296
type binding
ligand SIA: O-SIALIC ACID
sequence V
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_384

77) chain B
residue 298
type binding
ligand SIA: O-SIALIC ACID
sequence H
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_384

78) chain C
residue 85
type binding
ligand SIA: O-SIALIC ACID
sequence D
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_384

79) chain B
residue 77-80
type binding
ligand GAL: BETA-D-GALACTOSE
sequence RGIN
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_B_385

80) chain B
residue 91
type binding
ligand GAL: BETA-D-GALACTOSE
sequence G
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_B_385

81) chain B
residue 93-94
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_B_385

82) chain B
residue 296
type binding
ligand GAL: BETA-D-GALACTOSE
sequence V
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_B_385

83) chain B
residue 80
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_387

84) chain B
residue 87
type binding
ligand SIA: O-SIALIC ACID
sequence E
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_387

85) chain B
residue 89
type binding
ligand SIA: O-SIALIC ACID
sequence S
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_387

86) chain B
residue 91
type binding
ligand SIA: O-SIALIC ACID
sequence G
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_B_387

87) chain C
residue 72
type binding
ligand SIA: O-SIALIC ACID
sequence Y
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_C_384

88) chain C
residue 77-78
type binding
ligand SIA: O-SIALIC ACID
sequence RG
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_C_384

89) chain C
residue 289
type binding
ligand SIA: O-SIALIC ACID
sequence R
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_C_384

90) chain C
residue 291
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_C_384

91) chain C
residue 293
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_C_384

92) chain C
residue 296
type binding
ligand SIA: O-SIALIC ACID
sequence V
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_C_384

93) chain C
residue 298
type binding
ligand SIA: O-SIALIC ACID
sequence H
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_C_384

94) chain D
residue 85
type binding
ligand SIA: O-SIALIC ACID
sequence D
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_C_384

95) chain C
residue 77-80
type binding
ligand GAL: BETA-D-GALACTOSE
sequence RGIN
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_C_385

96) chain C
residue 93-94
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_C_385

97) chain C
residue 87
type binding
ligand SIA: O-SIALIC ACID
sequence E
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_C_387

98) chain C
residue 89
type binding
ligand SIA: O-SIALIC ACID
sequence S
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_C_387

99) chain D
residue 72
type binding
ligand SIA: O-SIALIC ACID
sequence Y
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_D_384

100) chain D
residue 77-78
type binding
ligand SIA: O-SIALIC ACID
sequence RG
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_D_384

101) chain D
residue 289
type binding
ligand SIA: O-SIALIC ACID
sequence R
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_D_384

102) chain D
residue 291
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_D_384

103) chain D
residue 293
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_D_384

104) chain D
residue 296
type binding
ligand SIA: O-SIALIC ACID
sequence V
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_D_384

105) chain D
residue 298
type binding
ligand SIA: O-SIALIC ACID
sequence H
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_D_384

106) chain E
residue 85
type binding
ligand SIA: O-SIALIC ACID
sequence D
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_D_384

107) chain D
residue 77-80
type binding
ligand GAL: BETA-D-GALACTOSE
sequence RGIN
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_D_385

108) chain D
residue 91
type binding
ligand GAL: BETA-D-GALACTOSE
sequence G
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_D_385

109) chain D
residue 93-94
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_D_385

110) chain D
residue 296
type binding
ligand GAL: BETA-D-GALACTOSE
sequence V
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_D_385

111) chain E
residue 77-80
type binding
ligand GAL: BETA-D-GALACTOSE
sequence RGIN
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_E_385

112) chain E
residue 93-94
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_E_385

113) chain E
residue 296
type binding
ligand GAL: BETA-D-GALACTOSE
sequence V
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_E_385

114) chain E
residue 80
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_387

115) chain E
residue 87
type binding
ligand SIA: O-SIALIC ACID
sequence E
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_387

116) chain E
residue 89
type binding
ligand SIA: O-SIALIC ACID
sequence S
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_387

117) chain E
residue 186
type binding
ligand SIA: O-SIALIC ACID
sequence K
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_E_387

118) chain F
residue 72
type binding
ligand SIA: O-SIALIC ACID
sequence Y
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_384

119) chain F
residue 77-78
type binding
ligand SIA: O-SIALIC ACID
sequence RG
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_384

120) chain F
residue 291
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_384

121) chain F
residue 293
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_384

122) chain F
residue 296
type binding
ligand SIA: O-SIALIC ACID
sequence V
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_384

123) chain F
residue 298
type binding
ligand SIA: O-SIALIC ACID
sequence H
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_384

124) chain F
residue 77-80
type binding
ligand GAL: BETA-D-GALACTOSE
sequence RGIN
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_F_385

125) chain F
residue 93-94
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_F_385

126) chain F
residue 296
type binding
ligand GAL: BETA-D-GALACTOSE
sequence V
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1sie_F_385

127) chain F
residue 87
type binding
ligand SIA: O-SIALIC ACID
sequence E
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_387

128) chain F
residue 89
type binding
ligand SIA: O-SIALIC ACID
sequence S
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_387

129) chain F
residue 186
type binding
ligand SIA: O-SIALIC ACID
sequence K
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1sie_F_387


Display surface

Download
Links