eF-site ID 1sh9-AB PDB Code 1sh9 Chain A, B click to enlarge Title Comparing the Accumulation of Active Site and Non-active Site Mutations in the HIV-1 Protease Classification HYDROLASE/HYDROLASE INHIBITOR Compound POL polyprotein Source Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) (HIV-1) (POL_HV1BR) Sequence A:  PQITLWQRPLVTIKIGGQLREALLDTGADDTIFEEISLPG RWKPKMIGGIGGFVKVRQYDQIPIEICGHKVIGTVLVGPT PANVIGRNLMTQIGCTLNF B:  PQITLWQRPLVTIKIGGQLREALLDTGADDTIFEEISLPG RWKPKMIGGIGGFVKVRQYDQIPIEICGHKVIGTVLVGPT PANVIGRNLMTQIGCTLNF Description Functional site 1) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 2) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 3) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 4) chain A residue 28 type sequence A description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 5) chain A residue 29 type sequence D description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 6) chain A residue 32 type sequence I description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 7) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 8) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 9) chain A residue 50 type sequence I description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 10) chain A residue 81 type sequence P description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 11) chain B residue 8 type sequence R description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 12) chain B residue 25 type sequence D description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 13) chain B residue 27 type sequence G description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 14) chain B residue 30 type sequence D description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 15) chain B residue 47 type sequence I description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 16) chain B residue 48 type sequence G description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 17) chain B residue 49 type sequence G description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 18) chain B residue 50 type sequence I description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 19) chain B residue 81 type sequence P description BINDING SITE FOR RESIDUE RIT B 301 source : AC1 20) chain A residue 64 type SITE sequence I description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 21) chain B residue 64 type SITE sequence I description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 64 type MOD_RES sequence I description Phosphotyrosine; by host => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 23) chain B residue 64 type MOD_RES sequence I description Phosphotyrosine; by host => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 22-33 type prosite sequence ALLDTGADDTIF description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADDTIF source prosite : PS00141

Display surface Download Links