eF-site ID 1sfj-A PDB Code 1sfj Chain A click to enlarge Title 2.4A Crystal structure of Staphylococcus aureus type I 3-dehydroquinase, with 3-dehydroquinate bound Classification LYASE Compound 3-dehydroquinate dehydratase Source Staphylococcus aureus (strain MRSA252) (AROD_STAAR) Sequence A:  HVEVVATITPQETLIQKINHRIDAIDVLELRIDQFENVTV DQVAEMITKLSFKLLVTYRTKLQGGYGQFTNDSYLNLISD LANINGIDMIDIEWQADIDIEKHQRIITHLQQYNKEVIIS HHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDV LNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGA LTYGCIGEPQAPGQIDVTDLKAQVTLY Description Functional site 1) chain A residue 9 type sequence T description BINDING SITE FOR RESIDUE DHK A 239 source : AC1 2) chain A residue 35 type sequence E description BINDING SITE FOR RESIDUE DHK A 239 source : AC1 3) chain A residue 37 type sequence R description BINDING SITE FOR RESIDUE DHK A 239 source : AC1 4) chain A residue 70 type sequence R description BINDING SITE FOR RESIDUE DHK A 239 source : AC1 5) chain A residue 133 type sequence H description BINDING SITE FOR RESIDUE DHK A 239 source : AC1 6) chain A residue 160 type sequence K description BINDING SITE FOR RESIDUE DHK A 239 source : AC1 7) chain A residue 202 type sequence R description BINDING SITE FOR RESIDUE DHK A 239 source : AC1 8) chain A residue 214 type sequence Y description BINDING SITE FOR RESIDUE DHK A 239 source : AC1 9) chain A residue 222 type sequence A description BINDING SITE FOR RESIDUE DHK A 239 source : AC1 10) chain A residue 225 type sequence Q description BINDING SITE FOR RESIDUE DHK A 239 source : AC1 11) chain A residue 133 type ACT_SITE sequence H description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_00214, ECO:0000269|PubMed:15229896 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 160 type ACT_SITE sequence K description Schiff-base intermediate with substrate => ECO:0000255|HAMAP-Rule:MF_00214, ECO:0000269|PubMed:15229896 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 35 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_00214 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 70 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_00214, ECO:0000269|PubMed:15229896 source Swiss-Prot : SWS_FT_FI4 15) chain A residue 202 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_00214, ECO:0000269|PubMed:15229896 source Swiss-Prot : SWS_FT_FI4 16) chain A residue 225 type BINDING sequence Q description BINDING => ECO:0000255|HAMAP-Rule:MF_00214, ECO:0000269|PubMed:15229896 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links