eF-site ID 1sfd-AB PDB Code 1sfd Chain A, B click to enlarge Title oxidized form of amicyanin mutant P94F Classification ELECTRON TRANSPORT Compound Amicyanin Source Paracoccus denitrificans (AMCY_PARDE) Sequence A:  DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVG DTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSL TFTEAGTYDYHCTFHPFMRGKVVVE B:  DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVG DTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSL TFTEAGTYDYHCTFHPFMRGKVVVE Description Functional site 1) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE CU A 107 source : AC1 2) chain A residue 92 type sequence C description BINDING SITE FOR RESIDUE CU A 107 source : AC1 3) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE CU A 107 source : AC1 4) chain A residue 98 type sequence M description BINDING SITE FOR RESIDUE CU A 107 source : AC1 5) chain B residue 53 type sequence H description BINDING SITE FOR RESIDUE CU B 107 source : AC2 6) chain B residue 92 type sequence C description BINDING SITE FOR RESIDUE CU B 107 source : AC2 7) chain B residue 95 type sequence H description BINDING SITE FOR RESIDUE CU B 107 source : AC2 8) chain B residue 98 type sequence M description BINDING SITE FOR RESIDUE CU B 107 source : AC2 9) chain A residue 49 type sequence E description BINDING SITE FOR RESIDUE SO4 A 501 source : AC3 10) chain A residue 50 type sequence A description BINDING SITE FOR RESIDUE SO4 A 501 source : AC3 11) chain A residue 74 type sequence K description BINDING SITE FOR RESIDUE SO4 A 501 source : AC3 12) chain B residue 49 type sequence E description BINDING SITE FOR RESIDUE SO4 B 502 source : AC4 13) chain B residue 50 type sequence A description BINDING SITE FOR RESIDUE SO4 B 502 source : AC4 14) chain B residue 74 type sequence K description BINDING SITE FOR RESIDUE SO4 B 502 source : AC4 15) chain B residue 58 type sequence V description BINDING SITE FOR RESIDUE SO4 B 503 source : AC5 16) chain B residue 59 type sequence A description BINDING SITE FOR RESIDUE SO4 B 503 source : AC5 17) chain B residue 56 type sequence H description BINDING SITE FOR RESIDUE SO4 B 504 source : AC6 18) chain B residue 68 type sequence K description BINDING SITE FOR RESIDUE SO4 B 504 source : AC6 19) chain A residue 56 type sequence H description BINDING SITE FOR RESIDUE SO4 A 505 source : AC7 20) chain B residue 38 type sequence K description BINDING SITE FOR RESIDUE SO4 A 505 source : AC7 21) chain B residue 50 type sequence A description BINDING SITE FOR RESIDUE SO4 A 505 source : AC7 22) chain A residue 53 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 23) chain A residue 92 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 24) chain A residue 95 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 25) chain A residue 98 type BINDING sequence M description source Swiss-Prot : SWS_FT_FI1 26) chain B residue 53 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 27) chain B residue 92 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 28) chain B residue 95 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 29) chain B residue 98 type BINDING sequence M description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links