eF-site ID 1sfd-A PDB Code 1sfd Chain A click to enlarge Title oxidized form of amicyanin mutant P94F Classification ELECTRON TRANSPORT Compound Amicyanin Source Paracoccus denitrificans (AMCY_PARDE) Sequence A:  DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVG DTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSL TFTEAGTYDYHCTFHPFMRGKVVVE Description Functional site 1) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE CU A 107 source : AC1 2) chain A residue 92 type sequence C description BINDING SITE FOR RESIDUE CU A 107 source : AC1 3) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE CU A 107 source : AC1 4) chain A residue 98 type sequence M description BINDING SITE FOR RESIDUE CU A 107 source : AC1 5) chain A residue 49 type sequence E description BINDING SITE FOR RESIDUE SO4 A 501 source : AC3 6) chain A residue 50 type sequence A description BINDING SITE FOR RESIDUE SO4 A 501 source : AC3 7) chain A residue 74 type sequence K description BINDING SITE FOR RESIDUE SO4 A 501 source : AC3 8) chain A residue 56 type sequence H description BINDING SITE FOR RESIDUE SO4 A 505 source : AC7 9) chain A residue 53 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 10) chain A residue 92 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 11) chain A residue 95 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain A residue 98 type BINDING sequence M description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links