eF-site ID 1sed-A PDB Code 1sed Chain A click to enlarge Title Crystal Structure of Protein of Unknown Function YhaL from Bacillus subtilis Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION Compound Hypothetical protein yhaI Source Bacillus subtilis (YHAI_BACSU) Sequence A:  DSMDHRIERLEYYIQLLVKTVDMDRYPFYALLIDKGLSKE EGEAVMRICDELSEELATQKAQGFVTFDKLLALFAGQLNE KLDVHETIFALYEQGLYQELMEVFIDIMKHFD Description Functional site 1) chain A residue 52 type sequence E description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 2) chain A residue 55 type sequence E description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 3) chain A residue 107 type sequence D description BINDING SITE FOR RESIDUE ZN B 502 source : AC2 4) chain A residue 111 type sequence H description BINDING SITE FOR RESIDUE ZN B 502 source : AC2 5) chain A residue 77 type sequence G description BINDING SITE FOR RESIDUE NA A 504 source : AC4 6) chain A residue 51 type sequence D description BINDING SITE FOR RESIDUE MPD A 701 source : AC7 7) chain A residue 69 type sequence D description BINDING SITE FOR RESIDUE MPD A 702 source : AC8 8) chain A residue 73 type sequence A description BINDING SITE FOR RESIDUE MPD A 702 source : AC8 9) chain A residue 85 type sequence V description BINDING SITE FOR RESIDUE MPD A 703 source : AC9 10) chain A residue 109 type sequence M description BINDING SITE FOR RESIDUE MPD A 703 source : AC9 11) chain A residue 112 type sequence F description BINDING SITE FOR RESIDUE MPD A 703 source : AC9 12) chain A residue 113 type sequence D description BINDING SITE FOR RESIDUE MPD A 703 source : AC9 13) chain A residue 111 type sequence H description BINDING SITE FOR RESIDUE MPD B 704 source : BC1 14) chain A residue 112 type sequence F description BINDING SITE FOR RESIDUE MPD B 704 source : BC1 15) chain A residue 10 type sequence R description BINDING SITE FOR RESIDUE MPD C 707 source : BC4 16) chain A residue 56 type sequence E description BINDING SITE FOR RESIDUE MPD A 712 source : BC9 17) chain A residue 70 type sequence K description BINDING SITE FOR RESIDUE MPD A 714 source : CC2 18) chain A residue 69 type sequence D description BINDING SITE FOR RESIDUE MPD A 715 source : CC3 19) chain A residue 70 type sequence K description BINDING SITE FOR RESIDUE MPD A 715 source : CC3 20) chain A residue 73 type sequence A description BINDING SITE FOR RESIDUE MPD A 715 source : CC3 21) chain A residue 61 type sequence K description BINDING SITE FOR RESIDUE MPD B 716 source : CC4 22) chain A residue 62 type sequence A description BINDING SITE FOR RESIDUE MPD B 716 source : CC4 23) chain A residue 63 type sequence Q description BINDING SITE FOR RESIDUE MPD B 716 source : CC4 24) chain A residue 64 type sequence G description BINDING SITE FOR RESIDUE MPD B 716 source : CC4 25) chain A residue 76 type sequence A description BINDING SITE FOR RESIDUE GOL A 801 source : CC6 26) chain A residue 77 type sequence G description BINDING SITE FOR RESIDUE GOL A 801 source : CC6 27) chain A residue 79 type sequence L description BINDING SITE FOR RESIDUE GOL A 801 source : CC6 28) chain A residue 77 type sequence G description BINDING SITE FOR RESIDUE GOL A 802 source : CC7 29) chain A residue 78 type sequence Q description BINDING SITE FOR RESIDUE GOL A 802 source : CC7 30) chain A residue 63 type sequence Q description BINDING SITE FOR RESIDUE GOL B 804 source : CC9 31) chain A residue 64 type sequence G description BINDING SITE FOR RESIDUE GOL B 804 source : CC9 32) chain A residue 65 type sequence F description BINDING SITE FOR RESIDUE GOL B 804 source : CC9

Display surface Download Links