eF-site ID 1saf_58-ABCD PDB Code 1saf Model 58 Chain A, B, C, D click to enlarge Title HIGH RESOLUTION SOLUTION NMR STRUCTURE OF THE OLIGOMERIZATION DOMAIN OF P53 BY MULTI-DIMENSIONAL NMR (SAD STRUCTURES) Classification ANTI-ONCOGENE Compound TUMOR SUPPRESSOR P53 Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens; Sequence A:  KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKE PG B:  KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKE PG C:  KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKE PG D:  KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKE PG Description Functional site 1) chain A residue 321 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P02340 source Swiss-Prot : SWS_FT_FI1 2) chain B residue 321 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P02340 source Swiss-Prot : SWS_FT_FI1 3) chain C residue 321 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P02340 source Swiss-Prot : SWS_FT_FI1 4) chain D residue 321 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P02340 source Swiss-Prot : SWS_FT_FI1 5) chain A residue 333 type MOD_RES sequence R description Omega-N-methylarginine; by PRMT5 => ECO:0000269|PubMed:19011621 source Swiss-Prot : SWS_FT_FI2 6) chain B residue 333 type MOD_RES sequence R description Omega-N-methylarginine; by PRMT5 => ECO:0000269|PubMed:19011621 source Swiss-Prot : SWS_FT_FI2 7) chain C residue 333 type MOD_RES sequence R description Omega-N-methylarginine; by PRMT5 => ECO:0000269|PubMed:19011621 source Swiss-Prot : SWS_FT_FI2 8) chain D residue 333 type MOD_RES sequence R description Omega-N-methylarginine; by PRMT5 => ECO:0000269|PubMed:19011621 source Swiss-Prot : SWS_FT_FI2 9) chain A residue 335 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5 => ECO:0000269|PubMed:19011621 source Swiss-Prot : SWS_FT_FI3 10) chain A residue 337 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5 => ECO:0000269|PubMed:19011621 source Swiss-Prot : SWS_FT_FI3 11) chain B residue 335 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5 => ECO:0000269|PubMed:19011621 source Swiss-Prot : SWS_FT_FI3 12) chain B residue 337 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5 => ECO:0000269|PubMed:19011621 source Swiss-Prot : SWS_FT_FI3 13) chain C residue 335 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5 => ECO:0000269|PubMed:19011621 source Swiss-Prot : SWS_FT_FI3 14) chain C residue 337 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5 => ECO:0000269|PubMed:19011621 source Swiss-Prot : SWS_FT_FI3 15) chain D residue 335 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5 => ECO:0000269|PubMed:19011621 source Swiss-Prot : SWS_FT_FI3 16) chain D residue 337 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5 => ECO:0000269|PubMed:19011621 source Swiss-Prot : SWS_FT_FI3 17) chain A residue 351 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:19033443 source Swiss-Prot : SWS_FT_FI4 18) chain D residue 351 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:19033443 source Swiss-Prot : SWS_FT_FI4 19) chain D residue 357 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:19033443 source Swiss-Prot : SWS_FT_FI4 20) chain A residue 357 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:19033443 source Swiss-Prot : SWS_FT_FI4 21) chain B residue 351 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:19033443 source Swiss-Prot : SWS_FT_FI4 22) chain B residue 357 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:19033443 source Swiss-Prot : SWS_FT_FI4 23) chain C residue 351 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:19033443 source Swiss-Prot : SWS_FT_FI4 24) chain C residue 357 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:19033443 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links