eF-site ID 1s4i-A PDB Code 1s4i Chain A click to enlarge Title Crystal structure of a SOD-like protein from Bacillus subtilis Classification OXIDOREDUCTASE Compound superoxide dismutase-like protein yojM Source Bacillus subtilis (YOJM_BACSU) Sequence A:  AFGHHVQLVNREGKAVGFIEIKESDDEGLDIHISANSLRP GASLGFHIYEKGSCVRPDFESAGGPFNPLNKEHGFNNPMG HHAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDED GSAFIIHEQADDYLTNPSGNSGARIVCGALL Description (1)  Hypothetical superoxide dismutase-like protein yojM precursor (E.C.1.15.1.1) Functional site 1) chain A residue 112 type sequence H description BINDING SITE FOR RESIDUE ZN A 501 source : AC3 2) chain A residue 121 type sequence H description BINDING SITE FOR RESIDUE ZN A 501 source : AC3 3) chain A residue 124 type sequence D description BINDING SITE FOR RESIDUE ZN A 501 source : AC3 4) chain A residue 86 type sequence H description BINDING SITE FOR RESIDUE CL A 502 source : AC4 5) chain A residue 112 type sequence H description BINDING SITE FOR RESIDUE CL A 502 source : AC4 6) chain A residue 121 type sequence H description BINDING SITE FOR RESIDUE CL A 502 source : AC4 7) chain A residue 124 type sequence D description BINDING SITE FOR RESIDUE CL A 502 source : AC4 8) chain A residue 177 type sequence S description BINDING SITE FOR RESIDUE CL A 502 source : AC4 9) chain A residue 71 type sequence H description BINDING SITE FOR RESIDUE ZN A 802 source : BC1 10) chain A residue 137 type sequence D description BINDING SITE FOR RESIDUE ZN A 802 source : BC1 11) chain A residue 71 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain A residue 137 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 13) chain A residue 86 type BINDING sequence H description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 14) chain A residue 166 type BINDING sequence H description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links