eF-site ID 1s32-H
PDB Code 1s32
Chain H

click to enlarge
Title Molecular Recognition of the Nucleosomal 'Supergroove'
Classification STRUCTURAL PROTEIN/DNA
Compound palindromic alpha-satellite 146 bp DNA fragment
Source Homo sapiens (Human) (CAD89678)
Sequence H:  KRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVN
DVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELA
KHAVSEGTKAVTKYTSAK
Description (1)  histone H3, H4, H2A, H2B/palindromic alpha-satellite 146 bp DNA/polyamide dimer clamp Complex


Functional site

1) chain H
residue 1487
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL G 2016
source : BC7

2) chain H
residue 1488
type
ligand
sequence S
description BINDING SITE FOR RESIDUE CL G 2016
source : BC7

3) chain H
residue 1489-1511
type prosite
ligand
sequence REIQTAVRLLLPGELAKHAVSEG
description Histone H2B signature. [KR]-E-[LIVM]-[EQ]-T-x(2)-[KR]-x-[LIVM](2)-x-[PAG]-[DE]-L-x-[KR]-H-A
source prosite : PS00357


Display surface

Download
Links