eF-site ID 1s32-G
PDB Code 1s32
Chain G

click to enlarge
Title Molecular Recognition of the Nucleosomal 'Supergroove'
Classification STRUCTURAL PROTEIN/DNA
Compound palindromic alpha-satellite 146 bp DNA fragment
Source Homo sapiens (Human) (CAD89678)
Sequence G:  KAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLA
AVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEE
LNKLLGRVTIAQGGVLPNIQSVLLPKK
Description (1)  histone H3, H4, H2A, H2B/palindromic alpha-satellite 146 bp DNA/polyamide dimer clamp Complex


Functional site

1) chain G
residue 1044
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CL G 2016
source : BC7

2) chain G
residue 1045
type
ligand
sequence A
description BINDING SITE FOR RESIDUE CL G 2016
source : BC7

3) chain G
residue 1046
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CL G 2016
source : BC7

4) chain G
residue 1047
type
ligand
sequence A
description BINDING SITE FOR RESIDUE CL G 2016
source : BC7

5) chain G
residue 1013
type
ligand
sequence K
description BINDING SITE FOR RESIDUE PYB I 1629
source : EC2

6) chain G
residue 1014
type
ligand
sequence A
description BINDING SITE FOR RESIDUE BAL I 1630
source : EC3

7) chain G
residue 1013-1014
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence KA
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1629

8) chain G
residue 1014
type binding
ligand BAL: BETA-ALANINE
sequence A
description BETA-ALANINE binding site
source pdb_hetatom : BAL_1s32_I_1630


Display surface

Download
Links