eF-site ID 1s32-E
PDB Code 1s32
Chain E

click to enlarge
Title Molecular Recognition of the Nucleosomal 'Supergroove'
Classification STRUCTURAL PROTEIN/DNA
Compound palindromic alpha-satellite 146 bp DNA fragment
Source Homo sapiens (Human) (CAD89678)
Sequence E:  KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKR
VTIMPKDIQLARRIRGERA
Description (1)  histone H3, H4, H2A, H2B/palindromic alpha-satellite 146 bp DNA/polyamide dimer clamp Complex


Functional site

1) chain E
residue 677
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN E 2001
source : AC1

2) chain E
residue 721
type
ligand
sequence P
description BINDING SITE FOR RESIDUE CL E 2015
source : BC6

3) chain E
residue 722
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CL E 2015
source : BC6


Display surface

Download
Links