eF-site ID 1s32-C
PDB Code 1s32
Chain C

click to enlarge
Title Molecular Recognition of the Nucleosomal 'Supergroove'
Classification STRUCTURAL PROTEIN/DNA
Compound palindromic alpha-satellite 146 bp DNA fragment
Source Homo sapiens (Human) (CAD89678)
Sequence C:  AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYL
AAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDE
ELNKLLGRVTIAQGGVLPNIQSVLLPK
Description (1)  histone H3, H4, H2A, H2B/palindromic alpha-satellite 146 bp DNA/polyamide dimer clamp Complex


Functional site

1) chain C
residue 846
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CL D 2018
source : BC9

2) chain C
residue 847
type
ligand
sequence A
description BINDING SITE FOR RESIDUE CL D 2018
source : BC9

3) chain C
residue 814
type binding
ligand BAL: BETA-ALANINE
sequence A
description BETA-ALANINE binding site
source pdb_hetatom : BAL_1s32_I_1610

4) chain C
residue 812
type binding
ligand IMT: 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID
sequence A
description 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : IMT_1s32_I_1601

5) chain C
residue 814
type binding
ligand IMT: 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID
sequence A
description 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : IMT_1s32_I_1601

6) chain C
residue 812
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence A
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1609

7) chain C
residue 814
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence A
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1609


Display surface

Download
Links