eF-site ID 1s32-B
PDB Code 1s32
Chain B

click to enlarge
Title Molecular Recognition of the Nucleosomal 'Supergroove'
Classification STRUCTURAL PROTEIN/DNA
Compound palindromic alpha-satellite 146 bp DNA fragment
Source Homo sapiens (Human) (CAD89678)
Sequence B:  LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVF
LENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
G
Description (1)  histone H3, H4, H2A, H2B/palindromic alpha-satellite 146 bp DNA/polyamide dimer clamp Complex

Display surface

Download
Links