eF-site ID 1s32-ABCDEFGHIJ
PDB Code 1s32
Chain A, B, C, D, E, F, G, H, I, J

click to enlarge
Title Molecular Recognition of the Nucleosomal 'Supergroove'
Classification STRUCTURAL PROTEIN/DNA
Compound palindromic alpha-satellite 146 bp DNA fragment
Source Homo sapiens (Human) (CAD89678)
Sequence A:  PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQD
FKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRV
TIMPKDIQLARRIRGERA
B:  LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVF
LENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
G
C:  AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYL
AAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDE
ELNKLLGRVTIAQGGVLPNIQSVLLPK
D:  DGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNS
FVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPG
ELAKHAVSEGTKAVTKYTSAK
E:  KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKR
VTIMPKDIQLARRIRGERA
F:  AKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEET
RGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQG
RTLYGFGG
G:  KAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLA
AVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEE
LNKLLGRVTIAQGGVLPNIQSVLLPKK
H:  KRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVN
DVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELA
KHAVSEGTKAVTKYTSAK
I:  ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGG
AAACTGCTCCATCAAAAGGCATGTTCAGCGGAATTCCGCT
GAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTT
GGTAGAATCTGCAGGTGGATATTGAT
J:  ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGG
AAACTGCTCCATCAAAAGGCATGTTCAGCGGAATTCCGCT
GAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTT
GGTAGAATCTGCAGGTGGATATTGAT
Description (1)  histone H3, H4, H2A, H2B/palindromic alpha-satellite 146 bp DNA/polyamide dimer clamp Complex


Functional site

1) chain D
residue 1245
type
ligand
sequence V
description BINDING SITE FOR RESIDUE MN E 2001
source : AC1

2) chain E
residue 677
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN E 2001
source : AC1

3) chain J
residue 246
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN J 2002
source : AC2

4) chain I
residue 70
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN I 2003
source : AC3

5) chain I
residue 71
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN I 2003
source : AC3

6) chain I
residue 134
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN I 2004
source : AC4

7) chain J
residue 280
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN J 2005
source : AC5

8) chain I
residue 100
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN I 2006
source : AC6

9) chain I
residue 39
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN I 2007
source : AC7

10) chain I
residue 40
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN I 2007
source : AC7

11) chain J
residue 266
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MN J 2008
source : AC8

12) chain J
residue 267
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN J 2008
source : AC8

13) chain I
residue 121
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN I 2009
source : AC9

14) chain J
residue 217
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN J 2010
source : BC1

15) chain J
residue 227
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN J 2011
source : BC2

16) chain J
residue 185
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN J 2013
source : BC4

17) chain J
residue 186
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN J 2013
source : BC4

18) chain I
residue 137
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN I 2014
source : BC5

19) chain I
residue 138
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MN I 2014
source : BC5

20) chain E
residue 721
type
ligand
sequence P
description BINDING SITE FOR RESIDUE CL E 2015
source : BC6

21) chain E
residue 722
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CL E 2015
source : BC6

22) chain G
residue 1044
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CL G 2016
source : BC7

23) chain G
residue 1045
type
ligand
sequence A
description BINDING SITE FOR RESIDUE CL G 2016
source : BC7

24) chain G
residue 1046
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CL G 2016
source : BC7

25) chain G
residue 1047
type
ligand
sequence A
description BINDING SITE FOR RESIDUE CL G 2016
source : BC7

26) chain H
residue 1487
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL G 2016
source : BC7

27) chain H
residue 1488
type
ligand
sequence S
description BINDING SITE FOR RESIDUE CL G 2016
source : BC7

28) chain A
residue 521
type
ligand
sequence P
description BINDING SITE FOR RESIDUE CL A 2017
source : BC8

29) chain A
residue 522
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CL A 2017
source : BC8

30) chain C
residue 846
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CL D 2018
source : BC9

31) chain C
residue 847
type
ligand
sequence A
description BINDING SITE FOR RESIDUE CL D 2018
source : BC9

32) chain D
residue 1287
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL D 2018
source : BC9

33) chain D
residue 1288
type
ligand
sequence S
description BINDING SITE FOR RESIDUE CL D 2018
source : BC9

34) chain I
residue 31
type
ligand
sequence G
description BINDING SITE FOR RESIDUE IMT I 1601
source : CC1

35) chain I
residue 32
type
ligand
sequence T
description BINDING SITE FOR RESIDUE IMT I 1601
source : CC1

36) chain I
residue 32
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PYB I 1602
source : CC2

37) chain I
residue 33
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PYB I 1602
source : CC2

38) chain I
residue 33
type
ligand
sequence G
description BINDING SITE FOR RESIDUE IMT I 1603
source : CC3

39) chain I
residue 34
type
ligand
sequence T
description BINDING SITE FOR RESIDUE IMT I 1603
source : CC3

40) chain I
residue 35
type
ligand
sequence A
description BINDING SITE FOR RESIDUE IMT I 1603
source : CC3

41) chain I
residue 34
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PYB I 1604
source : CC4

42) chain I
residue 35
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PYB I 1604
source : CC4

43) chain I
residue 36
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PYB I 1604
source : CC4

44) chain J
residue 259
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ABU I 1605
source : CC5

45) chain J
residue 260
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ABU I 1605
source : CC5

46) chain J
residue 259
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PYB I 1606
source : CC6

47) chain J
residue 260
type
ligand
sequence C
description BINDING SITE FOR RESIDUE PYB I 1606
source : CC6

48) chain J
residue 261
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PYB I 1606
source : CC6

49) chain J
residue 260
type
ligand
sequence C
description BINDING SITE FOR RESIDUE PYB I 1607
source : CC7

50) chain J
residue 261
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PYB I 1607
source : CC7

51) chain J
residue 261
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PYB I 1608
source : CC8

52) chain J
residue 262
type
ligand
sequence C
description BINDING SITE FOR RESIDUE PYB I 1608
source : CC8

53) chain J
residue 263
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PYB I 1608
source : CC8

54) chain I
residue 31
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PYB I 1609
source : CC9

55) chain J
residue 262
type
ligand
sequence C
description BINDING SITE FOR RESIDUE PYB I 1609
source : CC9

56) chain J
residue 263
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PYB I 1609
source : CC9

57) chain I
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE BAL I 1610
source : DC1

58) chain I
residue 31
type
ligand
sequence G
description BINDING SITE FOR RESIDUE BAL I 1610
source : DC1

59) chain J
residue 263
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BAL I 1610
source : DC1

60) chain I
residue 29
type
ligand
sequence A
description BINDING SITE FOR RESIDUE DIB I 1611
source : DC2

61) chain I
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE DIB I 1611
source : DC2

62) chain J
residue 265
type
ligand
sequence T
description BINDING SITE FOR RESIDUE DIB I 1611
source : DC2

63) chain J
residue 266
type
ligand
sequence T
description BINDING SITE FOR RESIDUE DIB I 1611
source : DC2

64) chain J
residue 178
type
ligand
sequence T
description BINDING SITE FOR RESIDUE IMT I 1621
source : DC3

65) chain J
residue 178
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PYB I 1622
source : DC4

66) chain J
residue 179
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PYB I 1622
source : DC4

67) chain J
residue 179
type
ligand
sequence G
description BINDING SITE FOR RESIDUE IMT I 1623
source : DC5

68) chain J
residue 180
type
ligand
sequence T
description BINDING SITE FOR RESIDUE IMT I 1623
source : DC5

69) chain J
residue 181
type
ligand
sequence A
description BINDING SITE FOR RESIDUE IMT I 1623
source : DC5

70) chain I
residue 113
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PYB I 1624
source : DC6

71) chain J
residue 180
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PYB I 1624
source : DC6

72) chain J
residue 181
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PYB I 1624
source : DC6

73) chain J
residue 182
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PYB I 1624
source : DC6

74) chain I
residue 113
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ABU I 1625
source : DC7

75) chain J
residue 181
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ABU I 1625
source : DC7

76) chain I
residue 113
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PYB I 1626
source : DC8

77) chain I
residue 114
type
ligand
sequence C
description BINDING SITE FOR RESIDUE PYB I 1626
source : DC8

78) chain I
residue 115
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PYB I 1626
source : DC8

79) chain I
residue 114
type
ligand
sequence C
description BINDING SITE FOR RESIDUE PYB I 1627
source : DC9

80) chain I
residue 115
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PYB I 1627
source : DC9

81) chain I
residue 116
type
ligand
sequence C
description BINDING SITE FOR RESIDUE PYB I 1627
source : DC9

82) chain I
residue 115
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PYB I 1628
source : EC1

83) chain I
residue 116
type
ligand
sequence C
description BINDING SITE FOR RESIDUE PYB I 1628
source : EC1

84) chain I
residue 117
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PYB I 1628
source : EC1

85) chain G
residue 1013
type
ligand
sequence K
description BINDING SITE FOR RESIDUE PYB I 1629
source : EC2

86) chain I
residue 116
type
ligand
sequence C
description BINDING SITE FOR RESIDUE PYB I 1629
source : EC2

87) chain I
residue 117
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PYB I 1629
source : EC2

88) chain I
residue 118
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PYB I 1629
source : EC2

89) chain J
residue 177
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PYB I 1629
source : EC2

90) chain G
residue 1014
type
ligand
sequence A
description BINDING SITE FOR RESIDUE BAL I 1630
source : EC3

91) chain J
residue 176
type
ligand
sequence A
description BINDING SITE FOR RESIDUE BAL I 1630
source : EC3

92) chain J
residue 177
type
ligand
sequence G
description BINDING SITE FOR RESIDUE BAL I 1630
source : EC3

93) chain I
residue 119
type
ligand
sequence T
description BINDING SITE FOR RESIDUE DIB I 1631
source : EC4

94) chain I
residue 120
type
ligand
sequence T
description BINDING SITE FOR RESIDUE DIB I 1631
source : EC4

95) chain J
residue 175
type
ligand
sequence A
description BINDING SITE FOR RESIDUE DIB I 1631
source : EC4

96) chain J
residue 176
type
ligand
sequence A
description BINDING SITE FOR RESIDUE DIB I 1631
source : EC4

97) chain I
residue 113
type
ligand
sequence A
description BINDING SITE FOR RESIDUE OGG J 1700
source : EC5

98) chain J
residue 259
type
ligand
sequence A
description BINDING SITE FOR RESIDUE OGG J 1700
source : EC5

99) chain D
residue 1289-1311
type prosite
ligand
sequence REIQTAVRLLLPGELAKHAVSEG
description Histone H2B signature. [KR]-E-[LIVM]-[EQ]-T-x(2)-[KR]-x-[LIVM](2)-x-[PAG]-[DE]-L-x-[KR]-H-A
source prosite : PS00357

100) chain H
residue 1489-1511
type prosite
ligand
sequence REIQTAVRLLLPGELAKHAVSEG
description Histone H2B signature. [KR]-E-[LIVM]-[EQ]-T-x(2)-[KR]-x-[LIVM](2)-x-[PAG]-[DE]-L-x-[KR]-H-A
source prosite : PS00357

101) chain I
residue 29-31
type binding
ligand DIB: 3-AMINO-(DIMETHYLPROPYLAMINE)
sequence AAG
description 3-AMINO-(DIMETHYLPROPYLAMINE) binding site
source pdb_hetatom : DIB_1s32_I_1611

102) chain J
residue 264-266
type binding
ligand DIB: 3-AMINO-(DIMETHYLPROPYLAMINE)
sequence TTT
description 3-AMINO-(DIMETHYLPROPYLAMINE) binding site
source pdb_hetatom : DIB_1s32_I_1611

103) chain I
residue 30-31
type binding
ligand BAL: BETA-ALANINE
sequence AG
description BETA-ALANINE binding site
source pdb_hetatom : BAL_1s32_I_1610

104) chain J
residue 263-265
type binding
ligand BAL: BETA-ALANINE
sequence TTT
description BETA-ALANINE binding site
source pdb_hetatom : BAL_1s32_I_1610

105) chain C
residue 814
type binding
ligand BAL: BETA-ALANINE
sequence A
description BETA-ALANINE binding site
source pdb_hetatom : BAL_1s32_I_1610

106) chain I
residue 31-33
type binding
ligand IMT: 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID
sequence GTG
description 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : IMT_1s32_I_1601

107) chain C
residue 812
type binding
ligand IMT: 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID
sequence A
description 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : IMT_1s32_I_1601

108) chain C
residue 814
type binding
ligand IMT: 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID
sequence A
description 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : IMT_1s32_I_1601

109) chain I
residue 31
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence G
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1609

110) chain J
residue 262-264
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence CTT
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1609

111) chain C
residue 812
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence A
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1609

112) chain C
residue 814
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence A
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1609

113) chain I
residue 31-33
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence GTG
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1602

114) chain I
residue 31
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence G
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1608

115) chain J
residue 261-263
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence ACT
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1608

116) chain I
residue 33-35
type binding
ligand IMT: 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID
sequence GTA
description 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : IMT_1s32_I_1603

117) chain I
residue 33-36
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence GTAT
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1604

118) chain J
residue 259-260
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence AC
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1604

119) chain I
residue 33
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence G
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1607

120) chain J
residue 260-262
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence CAC
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1607

121) chain I
residue 35-36
type binding
ligand ABU: GAMMA-AMINO-BUTANOIC ACID
sequence AT
description GAMMA-AMINO-BUTANOIC ACID binding site
source pdb_hetatom : ABU_1s32_I_1605

122) chain J
residue 259-260
type binding
ligand ABU: GAMMA-AMINO-BUTANOIC ACID
sequence AC
description GAMMA-AMINO-BUTANOIC ACID binding site
source pdb_hetatom : ABU_1s32_I_1605

123) chain I
residue 112-114
type binding
ligand ABU: GAMMA-AMINO-BUTANOIC ACID
sequence TAC
description GAMMA-AMINO-BUTANOIC ACID binding site
source pdb_hetatom : ABU_1s32_I_1625

124) chain J
residue 181-182
type binding
ligand ABU: GAMMA-AMINO-BUTANOIC ACID
sequence AT
description GAMMA-AMINO-BUTANOIC ACID binding site
source pdb_hetatom : ABU_1s32_I_1625

125) chain I
residue 112-113
type binding
ligand OGG: 2-(2-CARBAMOYLMETHOXY-ETHOXY)-ACETAMIDE
sequence TA
description 2-(2-CARBAMOYLMETHOXY-ETHOXY)-ACETAMIDE binding site
source pdb_hetatom : OGG_1s32_J_1700

126) chain J
residue 259-260
type binding
ligand OGG: 2-(2-CARBAMOYLMETHOXY-ETHOXY)-ACETAMIDE
sequence AC
description 2-(2-CARBAMOYLMETHOXY-ETHOXY)-ACETAMIDE binding site
source pdb_hetatom : OGG_1s32_J_1700

127) chain I
residue 113-115
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence ACA
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1626

128) chain I
residue 113-114
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence AC
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1624

129) chain J
residue 179-182
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence GTAT
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1624

130) chain I
residue 114-116
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence CAC
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1627

131) chain J
residue 179
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence G
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1627

132) chain I
residue 115-117
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence ACT
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1628

133) chain J
residue 179
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence G
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1628

134) chain I
residue 116-118
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence CTT
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1629

135) chain J
residue 177
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence G
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1629

136) chain G
residue 1013-1014
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence KA
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1629

137) chain I
residue 117-118
type binding
ligand BAL: BETA-ALANINE
sequence TT
description BETA-ALANINE binding site
source pdb_hetatom : BAL_1s32_I_1630

138) chain J
residue 176-177
type binding
ligand BAL: BETA-ALANINE
sequence AG
description BETA-ALANINE binding site
source pdb_hetatom : BAL_1s32_I_1630

139) chain G
residue 1014
type binding
ligand BAL: BETA-ALANINE
sequence A
description BETA-ALANINE binding site
source pdb_hetatom : BAL_1s32_I_1630

140) chain I
residue 118-120
type binding
ligand DIB: 3-AMINO-(DIMETHYLPROPYLAMINE)
sequence TTT
description 3-AMINO-(DIMETHYLPROPYLAMINE) binding site
source pdb_hetatom : DIB_1s32_I_1631

141) chain J
residue 175-177
type binding
ligand DIB: 3-AMINO-(DIMETHYLPROPYLAMINE)
sequence AAG
description 3-AMINO-(DIMETHYLPROPYLAMINE) binding site
source pdb_hetatom : DIB_1s32_I_1631

142) chain J
residue 177-179
type binding
ligand IMT: 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID
sequence GTG
description 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : IMT_1s32_I_1621

143) chain J
residue 178-180
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence TGT
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1622

144) chain J
residue 179-181
type binding
ligand IMT: 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID
sequence GTA
description 4-AMINO-(1-METHYLIMIDAZOLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : IMT_1s32_I_1623

145) chain J
residue 259-261
type binding
ligand PYB: 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID
sequence ACA
description 4-AMINO-(1-METHYLPYRROLE)-2-CARBOXYLIC ACID binding site
source pdb_hetatom : PYB_1s32_I_1606


Display surface

Download
Links