eF-site ID 1s2z-A PDB Code 1s2z Chain A click to enlarge Title X-ray crystal structure of Desulfovibrio vulgaris Rubrerythrin with displacement of iron by zinc at the diiron Site Classification ELECTRON TRANSPORT Compound Rubrerythrin Source Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) (RUBY_DESVH) Sequence A:  KSLKGSRTEKNILTAFAGESQARNRYNYFGGQAKKDGFVQ ISDIFAETADQEREHAKRLFKFLEGGDLEIVAAFPAGIIA DTHANLIASAAGEHHEYTEMYPSFARIAREEGYEEIARVF ASIAVAEEFHEKRFLDFARNIKEGRVFLREQATKWRCRNC GYVHEGTGAPELCPACAHPKAHFELLGINW Description Functional site 1) chain A residue 53 type sequence E description BINDING SITE FOR RESIDUE FE A 600 source : AC1 2) chain A residue 94 type sequence E description BINDING SITE FOR RESIDUE FE A 600 source : AC1 3) chain A residue 128 type sequence E description BINDING SITE FOR RESIDUE FE A 600 source : AC1 4) chain A residue 131 type sequence H description BINDING SITE FOR RESIDUE FE A 600 source : AC1 5) chain A residue 20 type sequence E description BINDING SITE FOR RESIDUE ZN A 601 source : AC2 6) chain A residue 53 type sequence E description BINDING SITE FOR RESIDUE ZN A 601 source : AC2 7) chain A residue 56 type sequence H description BINDING SITE FOR RESIDUE ZN A 601 source : AC2 8) chain A residue 128 type sequence E description BINDING SITE FOR RESIDUE ZN A 601 source : AC2 9) chain A residue 158 type sequence C description BINDING SITE FOR RESIDUE FE A 401 source : AC3 10) chain A residue 161 type sequence C description BINDING SITE FOR RESIDUE FE A 401 source : AC3 11) chain A residue 174 type sequence C description BINDING SITE FOR RESIDUE FE A 401 source : AC3 12) chain A residue 177 type sequence C description BINDING SITE FOR RESIDUE FE A 401 source : AC3 13) chain A residue 20 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12175244, ECO:0007744|PDB:1LKM source Swiss-Prot : SWS_FT_FI1 14) chain A residue 177 type BINDING sequence C description BINDING => ECO:0000269|PubMed:12175244, ECO:0007744|PDB:1LKM source Swiss-Prot : SWS_FT_FI1 15) chain A residue 53 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12175244, ECO:0007744|PDB:1LKM source Swiss-Prot : SWS_FT_FI1 16) chain A residue 94 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12175244, ECO:0007744|PDB:1LKM source Swiss-Prot : SWS_FT_FI1 17) chain A residue 97 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12175244, ECO:0007744|PDB:1LKM source Swiss-Prot : SWS_FT_FI1 18) chain A residue 128 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12175244, ECO:0007744|PDB:1LKM source Swiss-Prot : SWS_FT_FI1 19) chain A residue 131 type BINDING sequence H description BINDING => ECO:0000269|PubMed:12175244, ECO:0007744|PDB:1LKM source Swiss-Prot : SWS_FT_FI1 20) chain A residue 158 type BINDING sequence C description BINDING => ECO:0000269|PubMed:12175244, ECO:0007744|PDB:1LKM source Swiss-Prot : SWS_FT_FI1 21) chain A residue 161 type BINDING sequence C description BINDING => ECO:0000269|PubMed:12175244, ECO:0007744|PDB:1LKM source Swiss-Prot : SWS_FT_FI1 22) chain A residue 174 type BINDING sequence C description BINDING => ECO:0000269|PubMed:12175244, ECO:0007744|PDB:1LKM source Swiss-Prot : SWS_FT_FI1

Display surface Download Links