eF-site ID 1s2t-A PDB Code 1s2t Chain A click to enlarge Title Crystal Structure Of Apo Phosphoenolpyruvate Mutase Classification ISOMERASE Compound Phosphoenolpyruvate phosphomutase Source Mytilus edulis (Blue mussel) (PEPM_MYTED) Sequence A:  VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIW GSGLSVSAQLGVRDSNEASWTQVVEVLEFMSDASDVPILL DADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSL HDGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFI AGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMK AWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRA SVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDEL VQAEDKYLPKN Description Functional site 1) chain A residue 46 type catalytic sequence S description 271 source MCSA : MCSA1 2) chain A residue 123 type catalytic sequence S description 271 source MCSA : MCSA1 3) chain A residue 159 type catalytic sequence R description 271 source MCSA : MCSA1 4) chain A residue 190 type catalytic sequence H description 271 source MCSA : MCSA1 5) chain A residue 47 type catalytic sequence G description 271 source MCSA : MCSA1 6) chain A residue 48 type catalytic sequence L description 271 source MCSA : MCSA1 7) chain A residue 58 type catalytic sequence D description 271 source MCSA : MCSA1 8) chain A residue 85 type catalytic sequence D description 271 source MCSA : MCSA1 9) chain A residue 87 type catalytic sequence D description 271 source MCSA : MCSA1 10) chain A residue 114 type catalytic sequence E description 271 source MCSA : MCSA1 11) chain A residue 120 type catalytic sequence K description 271 source MCSA : MCSA1 12) chain A residue 122 type catalytic sequence N description 271 source MCSA : MCSA1 13) chain A residue 58 type ACT_SITE sequence D description Nucleophile => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 58 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links