eF-site ID 1rzf-L PDB Code 1rzf Chain L click to enlarge Title Crystal structure of Human anti-HIV-1 GP120-reactive antibody E51 Classification IMMUNE SYSTEM Compound Fab E51 light chain Source (1RZF) Sequence L:  QSILTQPPSVSAAPGQKVTISCSGSSSNIGNNDVSWYQQF PGTVPKLVIYENNERPSGIPDRFSGSKSGTSATLGITGLQ TGDEADYYCGTWDSSLSAVVFGGGSKVTVLGQPKAAPSVT LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVK AGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVT HEGSTVEKTVAPT Description Functional site 1) chain L residue 113 type sequence A description BINDING SITE FOR RESIDUE GOL L 9001 source : AC1 2) chain L residue 198 type sequence H description BINDING SITE FOR RESIDUE GOL L 9001 source : AC1 3) chain L residue 201 type sequence S description BINDING SITE FOR RESIDUE GOL L 9001 source : AC1 4) chain L residue 37 type sequence Q description BINDING SITE FOR RESIDUE GOL L 9002 source : AC2 5) chain L residue 45 type sequence K description BINDING SITE FOR RESIDUE GOL L 9002 source : AC2 6) chain L residue 59 type sequence P description BINDING SITE FOR RESIDUE GOL L 9002 source : AC2 7) chain L residue 61 type sequence R description BINDING SITE FOR RESIDUE GOL L 9002 source : AC2 8) chain L residue 62 type sequence F description BINDING SITE FOR RESIDUE GOL L 9002 source : AC2 9) chain L residue 81 type sequence G description BINDING SITE FOR RESIDUE GOL L 9002 source : AC2 10) chain L residue 82 type sequence D description BINDING SITE FOR RESIDUE GOL L 9002 source : AC2 11) chain L residue 115 type sequence S description BINDING SITE FOR RESIDUE GOL L 9003 source : AC3 12) chain L residue 117 type sequence T description BINDING SITE FOR RESIDUE GOL L 9003 source : AC3 13) chain L residue 136 type sequence L description BINDING SITE FOR RESIDUE GOL L 9003 source : AC3 14) chain L residue 137 type sequence I description BINDING SITE FOR RESIDUE GOL L 9003 source : AC3 15) chain L residue 138 type sequence S description BINDING SITE FOR RESIDUE GOL L 9003 source : AC3 16) chain L residue 105 type sequence T description BINDING SITE FOR RESIDUE GOL L 9004 source : AC4 17) chain L residue 106 type sequence V description BINDING SITE FOR RESIDUE GOL L 9004 source : AC4 18) chain L residue 107 type sequence L description BINDING SITE FOR RESIDUE GOL L 9004 source : AC4 19) chain L residue 108 type sequence G description BINDING SITE FOR RESIDUE GOL L 9004 source : AC4 20) chain L residue 109 type sequence Q description BINDING SITE FOR RESIDUE GOL L 9004 source : AC4 21) chain L residue 111 type sequence K description BINDING SITE FOR RESIDUE GOL L 9004 source : AC4 22) chain L residue 142 type sequence P description BINDING SITE FOR RESIDUE GOL L 9004 source : AC4 23) chain L residue 144 type sequence A description BINDING SITE FOR RESIDUE GOL L 9005 source : AC5 24) chain L residue 145 type sequence V description BINDING SITE FOR RESIDUE GOL L 9005 source : AC5 25) chain L residue 146 type sequence T description BINDING SITE FOR RESIDUE GOL L 9005 source : AC5 26) chain L residue 197 type sequence T description BINDING SITE FOR RESIDUE GOL L 9005 source : AC5 27) chain L residue 199 type sequence E description BINDING SITE FOR RESIDUE GOL L 9005 source : AC5 28) chain L residue 200 type sequence G description BINDING SITE FOR RESIDUE GOL L 9005 source : AC5 29) chain L residue 54 type sequence R description BINDING SITE FOR RESIDUE GOL L 9010 source : AC6 30) chain L residue 55 type sequence P description BINDING SITE FOR RESIDUE GOL L 9010 source : AC6 31) chain L residue 56 type sequence S description BINDING SITE FOR RESIDUE GOL L 9010 source : AC6 32) chain L residue 57 type sequence G description BINDING SITE FOR RESIDUE GOL L 9010 source : AC6 33) chain L residue 58 type sequence I description BINDING SITE FOR RESIDUE GOL L 9010 source : AC6 34) chain L residue 159 type sequence G description BINDING SITE FOR RESIDUE GOL L 9010 source : AC6 35) chain L residue 160 type sequence V description BINDING SITE FOR RESIDUE GOL L 9010 source : AC6 36) chain L residue 161 type sequence E description BINDING SITE FOR RESIDUE GOL L 9010 source : AC6 37) chain L residue 110 type sequence P description BINDING SITE FOR RESIDUE GOL L 9011 source : AC7 38) chain L residue 141 type sequence Y description BINDING SITE FOR RESIDUE GOL L 9011 source : AC7 39) chain L residue 171 type sequence N description BINDING SITE FOR RESIDUE GOL L 9011 source : AC7 40) chain L residue 65 type sequence S description BINDING SITE FOR RESIDUE GOL L 9012 source : AC8 41) chain L residue 66 type sequence K description BINDING SITE FOR RESIDUE GOL L 9012 source : AC8 42) chain L residue 67 type sequence S description BINDING SITE FOR RESIDUE GOL L 9012 source : AC8 43) chain L residue 70 type sequence S description BINDING SITE FOR RESIDUE GOL L 9012 source : AC8 44) chain L residue 71 type sequence A description BINDING SITE FOR RESIDUE GOL L 9012 source : AC8 45) chain L residue 72 type sequence T description BINDING SITE FOR RESIDUE GOL L 9012 source : AC8 46) chain L residue 18 type sequence K description BINDING SITE FOR RESIDUE GOL L 9013 source : AC9 47) chain L residue 20 type sequence T description BINDING SITE FOR RESIDUE GOL L 9013 source : AC9 48) chain L residue 63 type sequence S description BINDING SITE FOR RESIDUE GOL L 9013 source : AC9 49) chain L residue 64 type sequence G description BINDING SITE FOR RESIDUE GOL L 9013 source : AC9 50) chain L residue 65 type sequence S description BINDING SITE FOR RESIDUE GOL L 9013 source : AC9 51) chain L residue 38 type sequence Q description BINDING SITE FOR RESIDUE IPA L 7001 source : BC1 52) chain L residue 41 type sequence G description BINDING SITE FOR RESIDUE IPA L 7001 source : BC1 53) chain L residue 85 type sequence D description BINDING SITE FOR RESIDUE IPA L 7002 source : BC2 54) chain L residue 87 type sequence Y description BINDING SITE FOR RESIDUE IPA L 7002 source : BC2 55) chain L residue 100 type sequence G description BINDING SITE FOR RESIDUE IPA L 7002 source : BC2 56) chain L residue 32 type sequence D description BINDING SITE FOR RESIDUE GOL H 9006 source : BC3 57) chain L residue 34 type sequence S description BINDING SITE FOR RESIDUE GOL H 9006 source : BC3 58) chain L residue 36 type sequence Y description BINDING SITE FOR RESIDUE GOL H 9006 source : BC3 59) chain L residue 89 type sequence G description BINDING SITE FOR RESIDUE GOL H 9006 source : BC3 60) chain L residue 90 type sequence T description BINDING SITE FOR RESIDUE GOL H 9006 source : BC3 61) chain L residue 96 type sequence V description BINDING SITE FOR RESIDUE GOL H 9006 source : BC3 62) chain L residue 201 type sequence S description BINDING SITE FOR RESIDUE GOL H 9007 source : BC4 63) chain L residue 203 type sequence V description BINDING SITE FOR RESIDUE GOL H 9007 source : BC4 64) chain L residue 192-198 type prosite sequence YSCQVTH description IG_MHC Immunoglobulins and major histocompatibility complex proteins signature. YICNVNH source prosite : PS00290

Display surface Download Links