eF-site ID 1ryf-A PDB Code 1ryf Chain A click to enlarge Title Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase Classification HYDROLASE Compound ras-related C3 botulinum toxin substrate 1 isoform Rac1b Source Homo sapiens (Human) (RAC1_HUMAN) Sequence A:  GSMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFD NYSANVMVDGKPVNLGLWDTAIADVFLICFSLVSPASFEN VRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEK KLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEA IRAVLCPPPV Description Functional site 1) chain A residue 17 type sequence T description BINDING SITE FOR RESIDUE MG A 539 source : AC1 2) chain A residue 13 type sequence A description BINDING SITE FOR RESIDUE GDP A 538 source : AC3 3) chain A residue 14 type sequence V description BINDING SITE FOR RESIDUE GDP A 538 source : AC3 4) chain A residue 15 type sequence G description BINDING SITE FOR RESIDUE GDP A 538 source : AC3 5) chain A residue 16 type sequence K description BINDING SITE FOR RESIDUE GDP A 538 source : AC3 6) chain A residue 17 type sequence T description BINDING SITE FOR RESIDUE GDP A 538 source : AC3 7) chain A residue 18 type sequence C description BINDING SITE FOR RESIDUE GDP A 538 source : AC3 8) chain A residue 28 type sequence F description BINDING SITE FOR RESIDUE GDP A 538 source : AC3 9) chain A residue 135 type sequence K description BINDING SITE FOR RESIDUE GDP A 538 source : AC3 10) chain A residue 137 type sequence D description BINDING SITE FOR RESIDUE GDP A 538 source : AC3 11) chain A residue 138 type sequence L description BINDING SITE FOR RESIDUE GDP A 538 source : AC3 12) chain A residue 177 type sequence S description BINDING SITE FOR RESIDUE GDP A 538 source : AC3 13) chain A residue 178 type sequence A description BINDING SITE FOR RESIDUE GDP A 538 source : AC3 14) chain A residue 179 type sequence L description BINDING SITE FOR RESIDUE GDP A 538 source : AC3 15) chain A residue 13 type BINDING sequence A description BINDING => ECO:0000269|PubMed:11090627, ECO:0007744|PDB:1E96, ECO:0007744|PDB:2WKP, ECO:0007744|PDB:2WKQ, ECO:0007744|PDB:2WKR source Swiss-Prot : SWS_FT_FI1 16) chain A residue 30 type BINDING sequence G description BINDING => ECO:0000269|PubMed:11090627, ECO:0007744|PDB:1E96, ECO:0007744|PDB:2WKP, ECO:0007744|PDB:2WKQ, ECO:0007744|PDB:2WKR source Swiss-Prot : SWS_FT_FI1 17) chain A residue 135 type BINDING sequence K description BINDING => ECO:0000269|PubMed:11090627, ECO:0007744|PDB:1E96, ECO:0007744|PDB:2WKP, ECO:0007744|PDB:2WKQ, ECO:0007744|PDB:2WKR, ECO:0007744|PDB:5HZH source Swiss-Prot : SWS_FT_FI2 18) chain A residue 178 type BINDING sequence A description BINDING => ECO:0000269|PubMed:11090627, ECO:0007744|PDB:1E96, ECO:0007744|PDB:2WKP, ECO:0007744|PDB:2WKQ, ECO:0007744|PDB:2WKR, ECO:0007744|PDB:5HZH source Swiss-Prot : SWS_FT_FI2 19) chain A residue 166 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:18093184 source Swiss-Prot : SWS_FT_FI11 20) chain A residue 185 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:23512198 source Swiss-Prot : SWS_FT_FI12 21) chain A residue 189 type LIPID sequence D description S-geranylgeranyl cysteine => ECO:0000269|PubMed:1903399 source Swiss-Prot : SWS_FT_FI8 22) chain A residue 32 type CARBOHYD sequence Y description (Microbial infection) O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230; alternate => ECO:0000269|PubMed:24141704 source Swiss-Prot : SWS_FT_FI9 23) chain A residue 35 type CARBOHYD sequence T description (Microbial infection) O-linked (Glc) threonine; by C.difficile toxins TcdA and TcdB, and by P.sordellii toxin TcsL; alternate => ECO:0000269|PubMed:19744486, ECO:0000269|PubMed:24905543, ECO:0000269|PubMed:7775453, ECO:0000269|PubMed:7777059 source Swiss-Prot : SWS_FT_FI10 24) chain A residue 32 type MOD_RES sequence Y description (Microbial infection) O-AMP-tyrosine; by Haemophilus IbpA; alternate => ECO:0000269|PubMed:19362538 source Swiss-Prot : SWS_FT_FI3 25) chain A residue 35 type MOD_RES sequence T description (Microbial infection) O-AMP-threonine; by Vibrio VopS => ECO:0000269|PubMed:19039103 source Swiss-Prot : SWS_FT_FI4 26) chain A residue 189 type MOD_RES sequence D description Cysteine methyl ester => ECO:0000250|UniProtKB:P61585 source Swiss-Prot : SWS_FT_FI6 27) chain A residue 183 type LIPID sequence G description (Microbial infection) N6-palmitoyl lysine => ECO:0000269|PubMed:29074776 source Swiss-Prot : SWS_FT_FI7 28) chain A residue 184 type LIPID sequence L description (Microbial infection) N6-palmitoyl lysine => ECO:0000269|PubMed:29074776 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links