eF-site ID 1rwe-D PDB Code 1rwe Chain D click to enlarge Title Enhancing the activity of insulin at receptor edge: crystal structure and photo-cross-linking of A8 analogues Classification HORMONE/GROWTH FACTOR Compound insulin Source null (INS_HUMAN) Sequence D:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT Description Functional site 1) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 301 source : AC2 2) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 301 source : AC2 3) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 301 source : AC2 4) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 302 source : AC4 5) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 302 source : AC4 6) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 302 source : AC4 7) chain D residue 5 type sequence H description BINDING SITE FOR RESIDUE IPH C 200 source : AC5 8) chain D residue 11 type sequence L description BINDING SITE FOR RESIDUE IPH C 200 source : AC5

Display surface Download Links