eF-site ID 1rs4-A PDB Code 1rs4 Chain A click to enlarge Title DHNA, 7,8-Dihydroneopterin Aldolase complexed with 3-(5-Amino-7-hydroxy-[1,2,3]triazolo[4,5-d]pyrimidin-2-yl)-N-(3,5-dichlorobenzyl)-benzamide Classification LYASE Compound Dihydroneopterin aldolase Source Staphylococcus aureus (FOLB_STAAU) Sequence A:  MQDTIFLKGMRFYGYHGALSAENEIGQIFKVDVTLKVDLS EAGRTDNVIDTVHYGEVFEEVKSIMEGKAVNLLEHLAERI ANRINSQYNRVMETKVRITKENPPIPGHYDGVGIEIVREN K Description Functional site 1) chain A residue 18 type sequence A description BINDING SITE FOR RESIDUE 45P A 1001 source : AC1 2) chain A residue 51 type sequence T description BINDING SITE FOR RESIDUE 45P A 1001 source : AC1 3) chain A residue 52 type sequence V description BINDING SITE FOR RESIDUE 45P A 1001 source : AC1 4) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE 45P A 1001 source : AC1 5) chain A residue 54 type sequence Y description BINDING SITE FOR RESIDUE 45P A 1001 source : AC1 6) chain A residue 68 type sequence K description BINDING SITE FOR RESIDUE 45P A 1001 source : AC1 7) chain A residue 73 type sequence L description BINDING SITE FOR RESIDUE 45P A 1001 source : AC1 8) chain A residue 74 type sequence E description BINDING SITE FOR RESIDUE 45P A 1001 source : AC1 9) chain A residue 104 type sequence P description BINDING SITE FOR RESIDUE 45P A 1001 source : AC1 10) chain A residue 105 type sequence I description BINDING SITE FOR RESIDUE 45P A 1001 source : AC1 11) chain A residue 106 type sequence P description BINDING SITE FOR RESIDUE 45P A 1001 source : AC1 12) chain A residue 22 type catalytic sequence E description 664 source MCSA : MCSA1 13) chain A residue 100 type catalytic sequence K description 664 source MCSA : MCSA1 14) chain A residue 100 type ACT_SITE sequence K description Proton donor/acceptor => ECO:0000305|PubMed:17331536, ECO:0000305|PubMed:9586996 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 22 type BINDING sequence E description BINDING => ECO:0000305|PubMed:17331536, ECO:0000305|PubMed:9586996, ECO:0007744|PDB:2NM2 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 54 type BINDING sequence Y description BINDING => ECO:0000305|PubMed:17331536, ECO:0000305|PubMed:9586996, ECO:0007744|PDB:2NM2 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 73 type BINDING sequence L description BINDING => ECO:0000305|PubMed:17331536, ECO:0000305|PubMed:9586996, ECO:0007744|PDB:2NM2 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links