eF-site ID 1rri-A PDB Code 1rri Chain A click to enlarge Title DHNA complex with 3-(5-amino-7-hydroxy-[1,2,3] triazolo [4,5-d]pyrimidin-2-yl)-benzoic acid Classification LYASE Compound Dihydroneopterin aldolase Source Staphylococcus aureus (FOLB_STAAU) Sequence A:  MQDTIFLKGMRFYGYHGALSAENEIGQIFKVDVTLKVDLS EAGRTDNVIDTVHYGEVFEEVKSIMEGKAVNLLEHLAERI ANRINSQYNRVMETKVRITKENPPIPGHYDGVGIEIVREN K Description Functional site 1) chain A residue 13 type sequence Y description BINDING SITE FOR RESIDUE A45 A 1001 source : AC1 2) chain A residue 14 type sequence G description BINDING SITE FOR RESIDUE A45 A 1001 source : AC1 3) chain A residue 15 type sequence Y description BINDING SITE FOR RESIDUE A45 A 1001 source : AC1 4) chain A residue 16 type sequence H description BINDING SITE FOR RESIDUE A45 A 1001 source : AC1 5) chain A residue 65 type sequence M description BINDING SITE FOR RESIDUE A45 A 1001 source : AC1 6) chain A residue 66 type sequence E description BINDING SITE FOR RESIDUE A45 A 1001 source : AC1 7) chain A residue 67 type sequence G description BINDING SITE FOR RESIDUE A45 A 1001 source : AC1 8) chain A residue 69 type sequence A description BINDING SITE FOR RESIDUE A45 A 1001 source : AC1 9) chain A residue 106 type sequence P description BINDING SITE FOR RESIDUE A45 A 1001 source : AC1 10) chain A residue 107 type sequence G description BINDING SITE FOR RESIDUE A45 A 1001 source : AC1 11) chain A residue 22 type catalytic sequence E description 664 source MCSA : MCSA1 12) chain A residue 100 type catalytic sequence K description 664 source MCSA : MCSA1 13) chain A residue 22 type BINDING sequence E description BINDING => ECO:0000305|PubMed:17331536, ECO:0000305|PubMed:9586996, ECO:0007744|PDB:2NM2 source Swiss-Prot : SWS_FT_FI2 14) chain A residue 54 type BINDING sequence Y description BINDING => ECO:0000305|PubMed:17331536, ECO:0000305|PubMed:9586996, ECO:0007744|PDB:2NM2 source Swiss-Prot : SWS_FT_FI2 15) chain A residue 73 type BINDING sequence L description BINDING => ECO:0000305|PubMed:17331536, ECO:0000305|PubMed:9586996, ECO:0007744|PDB:2NM2 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 100 type ACT_SITE sequence K description Proton donor/acceptor => ECO:0000305|PubMed:17331536, ECO:0000305|PubMed:9586996 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links