eF-site ID 1rqc-A PDB Code 1rqc Chain A click to enlarge Title Crystals of peptide deformylase from Plasmodium falciparum with ten subunits per asymmetric unit reveal critical characteristics of the active site for drug design Classification HYDROLASE Compound formylmethionine deformylase Source null (Q8I372_PLAF7) Sequence A:  KIVKYPDPILRRRSEEVTNFDDNLKRVVRKXFDIXYESKG IGLSAPQVNISKRIIVWNALYEKRKEENERIFINPSIVEQ SLVKLKLIEGCLSFPGIEGKVERPSIVSISYYDINGYKHL KILKGIHSRIFQHEFDHLNGTLFIDKXTQVDKKKVRPKLN ELIRDYKATHSEEPLEHH Description (1)  formylmethionine deformylase Functional site 1) chain A residue 112 type sequence Q description BINDING SITE FOR RESIDUE CO A 301 source : AC1 2) chain A residue 156 type sequence C description BINDING SITE FOR RESIDUE CO A 301 source : AC1 3) chain A residue 198 type sequence H description BINDING SITE FOR RESIDUE CO A 301 source : AC1 4) chain A residue 202 type sequence H description BINDING SITE FOR RESIDUE CO A 301 source : AC1

Display surface Download Links