eF-site ID 1rms-A PDB Code 1rms Chain A click to enlarge Title CRYSTAL STRUCTURES OF RIBONUCLEASE MS COMPLEXED WITH 3'-GUANYLIC ACID A GP*C ANALOGUE, 2'-DEOXY-2'-FLUOROGUANYLYL-3',5'-CYTIDINE Classification HYDROLASE(ENDORIBONUCLEASE) Compound RIBONUCLEASE MS Source Aspergillus phoenicis (Aspergillus saitoi) (RNMS_ASPSA) Sequence A:  ESCEYTCGSTCYWSSDVSAAKAKGYSLYESGDTIDDYPHE YHDYEGFDFPVSGTYYEYPIMSDYDVYTGGSPGADRVIFN GDDELAGVITHTGASGDDFVACSSS Description (1)  RIBONUCLEASE MS (E.C.3.1.4.23) COMPLEXED WITH 3'-GUANYLIC ACID Functional site 1) chain A residue 1 type sequence E description BINDING SITE FOR RESIDUE 3GP A 106 source : AC1 2) chain A residue 13 type sequence W description BINDING SITE FOR RESIDUE 3GP A 106 source : AC1 3) chain A residue 37 type sequence Y description BINDING SITE FOR RESIDUE 3GP A 106 source : AC1 4) chain A residue 39 type sequence H description BINDING SITE FOR RESIDUE 3GP A 106 source : AC1 5) chain A residue 41 type sequence Y description BINDING SITE FOR RESIDUE 3GP A 106 source : AC1 6) chain A residue 42 type sequence H description BINDING SITE FOR RESIDUE 3GP A 106 source : AC1 7) chain A residue 43 type sequence D description BINDING SITE FOR RESIDUE 3GP A 106 source : AC1 8) chain A residue 44 type sequence Y description BINDING SITE FOR RESIDUE 3GP A 106 source : AC1 9) chain A residue 45 type sequence E description BINDING SITE FOR RESIDUE 3GP A 106 source : AC1 10) chain A residue 57 type sequence E description BINDING SITE FOR RESIDUE 3GP A 106 source : AC1 11) chain A residue 76 type sequence R description BINDING SITE FOR RESIDUE 3GP A 106 source : AC1 12) chain A residue 91 type sequence H description BINDING SITE FOR RESIDUE 3GP A 106 source : AC1 13) chain A residue 97 type sequence D description BINDING SITE FOR RESIDUE 3GP A 106 source : AC1 14) chain A residue 99 type sequence F description BINDING SITE FOR RESIDUE 3GP A 106 source : AC1 15) chain A residue 39 type ACT_SITE sequence H description source Swiss-Prot : SWS_FT_FI1 16) chain A residue 57 type ACT_SITE sequence E description Proton acceptor source Swiss-Prot : SWS_FT_FI2 17) chain A residue 91 type ACT_SITE sequence H description Proton donor source Swiss-Prot : SWS_FT_FI3

Display surface Download Links