eF-site ID 1rkc-A
PDB Code 1rkc
Chain A

click to enlarge
Title Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues 1944-1969)
Classification cell adhesion, structural protein
Compound Vinculin
Source Gallus gallus (Chicken) (TLN1_CHICK)
Sequence A:  MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDL
TAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIK
VENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTY
TKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKE
LLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAW
Description (1)  vinculin/talin fragment complex

Display surface

Download
Links