eF-site ID 1rjw-A PDB Code 1rjw Chain A click to enlarge Title CRYSTAL STRUCTURE OF NAD(+)-DEPENDENT ALCOHOL DEHYDROGENASE FROM BACILLUS STEAROTHERMOPHILUS STRAIN LLD-R Classification OXIDOREDUCTASE Compound Alcohol dehydrogenase Source null (ADH3_BACST) Sequence A:  MKAAVVEQFKEPLKIKEVEKPTISYGEVLVRIKACGVCHT DLHAAHGDWPVKPKLPLIPGHEGVGIVEEVGPGVTHLKVG DRVGIPWLYSACGHCDYCLSGQETLCEHQKNAGYSVDGGY AEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKALKVT GAKPGEWVAIYGIGGLGHVAVQYAKAMGLNVVAVDIGDEK LELAKELGADLVVNPLKEDAAKFMKEKVGGVHAAVVTAVS KPAFQSAYNSIRRGGACVLVGLPPEEMPIPIFDTVLNGIK IIGSIVGTRKDLQEALQFAAEGKVKTIIEVQPLEKINEVF DRMLKGQINGRVVLTLEDK Description Functional site 1) chain A residue 92 type sequence C description STRUCTURAL ZINC SITE, CHAIN A source : ZN1 2) chain A residue 95 type sequence C description STRUCTURAL ZINC SITE, CHAIN A source : ZN1 3) chain A residue 98 type sequence C description STRUCTURAL ZINC SITE, CHAIN A source : ZN1 4) chain A residue 106 type sequence C description STRUCTURAL ZINC SITE, CHAIN A source : ZN1 5) chain A residue 38 type sequence C description CATALYTIC ZINC SITE, CHAIN A source : ZN2 6) chain A residue 61 type sequence H description CATALYTIC ZINC SITE, CHAIN A source : ZN2 7) chain A residue 148 type sequence C description CATALYTIC ZINC SITE, CHAIN A source : ZN2 8) chain A residue 92 type sequence C description BINDING SITE FOR RESIDUE ZN A 401 source : AC1 9) chain A residue 95 type sequence C description BINDING SITE FOR RESIDUE ZN A 401 source : AC1 10) chain A residue 98 type sequence C description BINDING SITE FOR RESIDUE ZN A 401 source : AC1 11) chain A residue 106 type sequence C description BINDING SITE FOR RESIDUE ZN A 401 source : AC1 12) chain A residue 38 type sequence C description BINDING SITE FOR RESIDUE ZN A 402 source : AC2 13) chain A residue 40 type sequence T description BINDING SITE FOR RESIDUE ZN A 402 source : AC2 14) chain A residue 61 type sequence H description BINDING SITE FOR RESIDUE ZN A 402 source : AC2 15) chain A residue 148 type sequence C description BINDING SITE FOR RESIDUE ZN A 402 source : AC2 16) chain A residue 38 type sequence C description BINDING SITE FOR RESIDUE ETF A 501 source : AC9 17) chain A residue 40 type sequence T description BINDING SITE FOR RESIDUE ETF A 501 source : AC9 18) chain A residue 61 type sequence H description BINDING SITE FOR RESIDUE ETF A 501 source : AC9 19) chain A residue 87 type sequence W description BINDING SITE FOR RESIDUE ETF A 501 source : AC9 20) chain A residue 148 type sequence C description BINDING SITE FOR RESIDUE ETF A 501 source : AC9 21) chain A residue 262 type sequence L description BINDING SITE FOR RESIDUE ETF A 501 source : AC9 22) chain A residue 285 type sequence I description BINDING SITE FOR RESIDUE ETF A 501 source : AC9 23) chain A residue 172 type sequence G description BINDING SITE FOR RESIDUE ETF A 607 source : CC1 24) chain A residue 194 type sequence V description BINDING SITE FOR RESIDUE ETF A 607 source : CC1 25) chain A residue 195 type sequence D description BINDING SITE FOR RESIDUE ETF A 607 source : CC1 26) chain A residue 196 type sequence I description BINDING SITE FOR RESIDUE ETF A 607 source : CC1 27) chain A residue 38 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 61 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 92 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 95 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 31) chain A residue 98 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 32) chain A residue 106 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 148 type BINDING sequence C description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 34) chain A residue 172 type BINDING sequence G description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 35) chain A residue 200 type BINDING sequence K description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 36) chain A residue 260 type BINDING sequence V description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 37) chain A residue 331 type BINDING sequence R description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 38) chain A residue 195 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 39) chain A residue 60-74 type prosite sequence GHEGVGIVEEVGPGV description ADH_ZINC Zinc-containing alcohol dehydrogenases signature. GHEgVGIveevGpgV source prosite : PS00059

Display surface Download Links