eF-site ID 1rdg-A PDB Code 1rdg Chain A click to enlarge Title RUBREDOXIN FROM DESULFOVIBRIO GIGAS. A MOLECULAR MODEL OF THE OXIDIZED FORM AT 1.4 ANGSTROMS RESOLUTION Classification ELECTRON TRANSFER(IRON-SULFUR PROTEIN) Compound RUBREDOXIN Source Desulfovibrio gigas (RUBR_DESGI) Sequence A:  MDIYVCTVCGYEYDPAKGDPDSGIKPGTKFEDLPDDWACP VCGASKDAFEKQ Description (1)  RUBREDOXIN Functional site 1) chain A residue 6 type sequence C description source : FE 2) chain A residue 9 type sequence C description source : FE 3) chain A residue 39 type sequence C description source : FE 4) chain A residue 42 type sequence C description source : FE 5) chain A residue 6 type sequence C description BINDING SITE FOR RESIDUE FE A 53 source : AC1 6) chain A residue 9 type sequence C description BINDING SITE FOR RESIDUE FE A 53 source : AC1 7) chain A residue 39 type sequence C description BINDING SITE FOR RESIDUE FE A 53 source : AC1 8) chain A residue 42 type sequence C description BINDING SITE FOR RESIDUE FE A 53 source : AC1 9) chain A residue 1 type sequence M description BINDING SITE FOR RESIDUE FOR A 0 source : AC2 10) chain A residue 21 type sequence D description BINDING SITE FOR RESIDUE FOR A 0 source : AC2 11) chain A residue 22 type sequence S description BINDING SITE FOR RESIDUE FOR A 0 source : AC2 12) chain A residue 6 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00241, ECO:0000269|PubMed:938515 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 9 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00241, ECO:0000269|PubMed:938515 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 39 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00241, ECO:0000269|PubMed:938515 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 42 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00241, ECO:0000269|PubMed:938515 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 1 type MOD_RES sequence M description N-formylmethionine => ECO:0000269|PubMed:3441010, ECO:0000269|PubMed:938515 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 33-43 type prosite sequence LPDDWACPVCG description RUBREDOXIN Rubredoxin signature. LpDDWaCPvCG source prosite : PS00202

Display surface Download Links