eF-site ID 1rcy-A PDB Code 1rcy Chain A click to enlarge Title RUSTICYANIN (RC) FROM THIOBACILLUS FERROOXIDANS Classification METALLOPROTEIN Compound RUSTICYANIN Source Thiobacillus ferrooxidans (Acidithiobacillus ferrooxidans) (RUS2_THIFE) Sequence A:  TTWKEATLPQVKAMLEKDDGKVSGDTVTYSGKTVHVVAAA VLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFG HSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTD FTWHPTAGTYYYVCQIPGHAATGMFGKIVVK Description Functional site 1) chain A residue 85 type sequence H description DISTORTED TETRAHEDRAL COORDINATION BY 2 HIS, 1 CYS, AND 1 MET RESIDUES OF THE CU(II) ATOM (CU). source : ASI 2) chain A residue 138 type sequence C description DISTORTED TETRAHEDRAL COORDINATION BY 2 HIS, 1 CYS, AND 1 MET RESIDUES OF THE CU(II) ATOM (CU). source : ASI 3) chain A residue 143 type sequence H description DISTORTED TETRAHEDRAL COORDINATION BY 2 HIS, 1 CYS, AND 1 MET RESIDUES OF THE CU(II) ATOM (CU). source : ASI 4) chain A residue 148 type sequence M description DISTORTED TETRAHEDRAL COORDINATION BY 2 HIS, 1 CYS, AND 1 MET RESIDUES OF THE CU(II) ATOM (CU). source : ASI 5) chain A residue 85 type sequence H description BINDING SITE FOR RESIDUE CU A 156 source : AC1 6) chain A residue 138 type sequence C description BINDING SITE FOR RESIDUE CU A 156 source : AC1 7) chain A residue 143 type sequence H description BINDING SITE FOR RESIDUE CU A 156 source : AC1 8) chain A residue 148 type sequence M description BINDING SITE FOR RESIDUE CU A 156 source : AC1 9) chain A residue 85 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 10) chain A residue 138 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 11) chain A residue 143 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain A residue 148 type BINDING sequence M description source Swiss-Prot : SWS_FT_FI1 13) chain A residue 132-152 type prosite sequence GTYYYVCQIPGHAATGMFGKI description MULTICOPPER_OXIDASE1 Multicopper oxidases signature 1. GtYyYvCqIPghAaTGMfgkI source prosite : PS00079 14) chain A residue 131-148 type prosite sequence AGTYYYVCQIPGHAATGM description COPPER_BLUE Type-1 copper (blue) proteins signature. AgtYyYVCqiPgHaatgM source prosite : PS00196

Display surface Download Links