eF-site ID 1r4n-K
PDB Code 1r4n
Chain K

click to enlarge
Title APPBP1-UBA3-NEDD8, an E1-ubiquitin-like protein complex with ATP
Classification CELL CYCLE
Compound amyloid beta precursor protein-binding protein 1
Source Homo sapiens (Human) (NEDD8_HUMAN)
Sequence K:  MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQ
QRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Description (1)  amyloid beta precursor protein-binding protein 1, ubiquitin-activating enzyme E1C, Ubiquitin-like protein NEDD8


Functional site

1) chain K
residue 176
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ATP F 7
source : AC7

2) chain K
residue 127-152
type prosite
ligand
sequence KERVEEKEGIPPQQQRLIYSGKQMND
description Ubiquitin domain signature.K-x(2)-[LIVM]-x-[DESAK]-x(3)-[LIVM]-[PAQ]-x(3)-Q-x-[LIVM]-[LIVMC]-[LIVMFY]-x-G-x(4)-[DE].
source prosite : PS00299


Display surface

Download
Links