eF-site ID 1r4n-I PDB Code 1r4n Chain I click to enlarge Title APPBP1-UBA3-NEDD8, an E1-ubiquitin-like protein complex with ATP Classification CELL CYCLE Compound amyloid beta precursor protein-binding protein 1 Source Homo sapiens (Human) (NEDD8_HUMAN) Sequence I:  MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQ QRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG Description Functional site 1) chain I residue 176 type sequence G description BINDING SITE FOR RESIDUE ATP B 5 source : AC5 2) chain I residue 127-152 type prosite sequence KERVEEKEGIPPQQQRLIYSGKQMND description UBIQUITIN_1 Ubiquitin domain signature. KerVeEkegIPpqqQrLIYsGkqmnD source prosite : PS00299 3) chain I residue 108 type SITE sequence L description Interaction with UBE1C => ECO:0000269|PubMed:14690597 source Swiss-Prot : SWS_FT_FI1 4) chain I residue 144 type SITE sequence I description Interaction with UBE1C => ECO:0000269|PubMed:14690597 source Swiss-Prot : SWS_FT_FI1 5) chain I residue 140 type MOD_RES sequence Q description (Microbial infection) Deamidated glutamine => ECO:0000269|PubMed:20688984, ECO:0000269|PubMed:21903097, ECO:0000269|PubMed:23175788, ECO:0000269|PubMed:23589306, ECO:0000269|PubMed:26632597 source Swiss-Prot : SWS_FT_FI2 6) chain I residue 148 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P29595 source Swiss-Prot : SWS_FT_FI3 7) chain I residue 176 type CROSSLNK sequence G description Glycyl lysine isopeptide (Gly-Lys) (interchain with K-? in acceptor proteins) source Swiss-Prot : SWS_FT_FI4

Display surface Download Links