eF-site ID 1r15-E PDB Code 1r15 Chain E click to enlarge Title Aplysia ADP ribosyl cyclase with bound nicotinamide and R5P Classification HYDROLASE Compound ADP-ribosyl cyclase Source Aplysia californica (California sea hare) (NADA_APLCA) Sequence E:  IVPTRELENVFLGRCKDYEITRYLDILPRVRSDCSALWKD FFKAFSFKNPCDLDLGSYKDFFTSAQQQLPKNKVMFWSGV YDEAHDYANTGRKYITLEDTLPGYMLNSLVWCGQRANPGF NEKVCPDFKTCPVQARESFWGMASSSYAHSAEGEVTYMVD GSNPKVPAYRPDSFFGKYELPNLTNKVTRVKVIVLHRLGE KIIEKCGAGSLLDLEKLVKAKHFAFDCVENPRAVLFLLCS DNPNARECRLA Description (1)  ADP-ribosyl cyclase (E.C.3.2.2.5) Functional site 1) chain E residue 110 type sequence V description BINDING SITE FOR RESIDUE NCA E 459 source : BC2 2) chain E residue 111 type sequence W description BINDING SITE FOR RESIDUE NCA E 459 source : BC2 3) chain E residue 140 type sequence W description BINDING SITE FOR RESIDUE NCA E 459 source : BC2 4) chain E residue 98 type sequence E description BINDING SITE FOR RESIDUE NCA E 359 source : BC7 5) chain E residue 107 type sequence N description BINDING SITE FOR RESIDUE NCA E 359 source : BC7 6) chain E residue 77 type sequence W description BINDING SITE FOR RESIDUE N E 1179 source : CC3 7) chain E residue 78 type sequence S description BINDING SITE FOR RESIDUE N E 1179 source : CC3 8) chain E residue 79 type sequence G description BINDING SITE FOR RESIDUE N E 1179 source : CC3 9) chain E residue 97 type sequence L description BINDING SITE FOR RESIDUE N E 1179 source : CC3 10) chain E residue 144 type sequence S description BINDING SITE FOR RESIDUE N E 1179 source : CC3 11) chain E residue 173 type sequence S description BINDING SITE FOR RESIDUE N E 1179 source : CC3 12) chain E residue 174 type sequence F description BINDING SITE FOR RESIDUE N E 1179 source : CC3 13) chain E residue 179 type sequence E description BINDING SITE FOR RESIDUE N E 1179 source : CC3 14) chain E residue 98 type catalytic sequence E description 607 source MCSA : MCSA5 15) chain E residue 174 type catalytic sequence F description 607 source MCSA : MCSA5 16) chain E residue 179 type catalytic sequence E description 607 source MCSA : MCSA5

Display surface Download Links