eF-site ID 1r10-A PDB Code 1r10 Chain A click to enlarge Title Cystic fibrosis transmembrane conductance regulator (CFTR) nucleotide-binding domain one (NBD1) with ATP, I4122 space group Classification TRANSPORT PROTEIN Compound Cystic fibrosis transmembrane conductance regulator Source (CFTR_MOUSE) Sequence A:  GIIMENVTAFWEEGFGELLEKVSFSHLCLVGNPVLKNINL NIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG RVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQL QQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK MEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMG YDTFDQFTEERRSSILTETLRRFS Description Functional site 1) chain A residue 465 type sequence T description BINDING SITE FOR RESIDUE MG A 3 source : AC1 2) chain A residue 493 type sequence Q description BINDING SITE FOR RESIDUE MG A 3 source : AC1 3) chain A residue 572 type sequence D description BINDING SITE FOR RESIDUE MG A 3 source : AC1 4) chain A residue 401 type sequence W description BINDING SITE FOR RESIDUE ATP A 1 source : AC3 5) chain A residue 409 type sequence L description BINDING SITE FOR RESIDUE ATP A 1 source : AC3 6) chain A residue 430 type sequence F description BINDING SITE FOR RESIDUE ATP A 1 source : AC3 7) chain A residue 461 type sequence G description BINDING SITE FOR RESIDUE ATP A 1 source : AC3 8) chain A residue 462 type sequence S description BINDING SITE FOR RESIDUE ATP A 1 source : AC3 9) chain A residue 463 type sequence G description BINDING SITE FOR RESIDUE ATP A 1 source : AC3 10) chain A residue 464 type sequence K description BINDING SITE FOR RESIDUE ATP A 1 source : AC3 11) chain A residue 465 type sequence T description BINDING SITE FOR RESIDUE ATP A 1 source : AC3 12) chain A residue 466 type sequence S description BINDING SITE FOR RESIDUE ATP A 1 source : AC3 13) chain A residue 542 type sequence G description BINDING SITE FOR RESIDUE ACY A 7 source : AC5 14) chain A residue 545 type sequence G description BINDING SITE FOR RESIDUE ACY A 7 source : AC5 15) chain A residue 546 type sequence V description BINDING SITE FOR RESIDUE ACY A 7 source : AC5 16) chain A residue 547 type sequence T description BINDING SITE FOR RESIDUE ACY A 7 source : AC5 17) chain A residue 578 type sequence L description BINDING SITE FOR RESIDUE ACY B 8 source : AC6 18) chain A residue 529 type sequence D description BINDING SITE FOR RESIDUE ACY A 9 source : AC7 19) chain A residue 532 type sequence K description BINDING SITE FOR RESIDUE ACY A 9 source : AC7 20) chain A residue 524 type LIPID sequence C description S-palmitoyl cysteine => ECO:0000250|UniProtKB:P13569 source Swiss-Prot : SWS_FT_FI6 21) chain A residue 670 type MOD_RES sequence S description Phosphoserine; by PKA => ECO:0000250|UniProtKB:P13569 source Swiss-Prot : SWS_FT_FI5 22) chain A residue 548-562 type prosite sequence LSGGQRARISLARAV description ABC_TRANSPORTER_1 ABC transporters family signature. LSGGQRARISLARAV source prosite : PS00211 23) chain A residue 401 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P13569 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 549 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P13569 source Swiss-Prot : SWS_FT_FI4 25) chain A residue 660 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P13569 source Swiss-Prot : SWS_FT_FI4 26) chain A residue 458 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00434, ECO:0007744|PDB:1Q3H, ECO:0007744|PDB:1R0X, ECO:0007744|PDB:1R0Z, ECO:0007744|PDB:1R10, ECO:0007744|PDB:1XF9, ECO:0007744|PDB:1XFA, ECO:0007744|PDB:3SI7 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 493 type BINDING sequence Q description BINDING => ECO:0007744|PDB:1Q3H, ECO:0007744|PDB:1R0X, ECO:0007744|PDB:1R0Z, ECO:0007744|PDB:1XFA source Swiss-Prot : SWS_FT_FI3

Display surface Download Links