eF-site ID 1r0x-A PDB Code 1r0x Chain A click to enlarge Title Cystic fibrosis transmembrane conductance regulator (CFTR) nucleotide-binding domain one (NBD1) with ATP Classification TRANSPORT PROTEIN Compound Cystic fibrosis transmembrane conductance regulator Source (CFTR_MOUSE) Sequence A:  TGIIMENVTAFWEEGFGELLEKSFSHLCLVGNPVLKNINL NIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG RVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQL QQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDA DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK MEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMG YDTFDQFTEERRSSILTETLRRFS Description Functional site 1) chain A residue 465 type sequence T description BINDING SITE FOR RESIDUE MG A 13 source : AC3 2) chain A residue 493 type sequence Q description BINDING SITE FOR RESIDUE MG A 13 source : AC3 3) chain A residue 401 type sequence W description BINDING SITE FOR RESIDUE ATP A 1 source : AC5 4) chain A residue 409 type sequence L description BINDING SITE FOR RESIDUE ATP A 1 source : AC5 5) chain A residue 430 type sequence F description BINDING SITE FOR RESIDUE ATP A 1 source : AC5 6) chain A residue 460 type sequence T description BINDING SITE FOR RESIDUE ATP A 1 source : AC5 7) chain A residue 461 type sequence G description BINDING SITE FOR RESIDUE ATP A 1 source : AC5 8) chain A residue 462 type sequence S description BINDING SITE FOR RESIDUE ATP A 1 source : AC5 9) chain A residue 463 type sequence G description BINDING SITE FOR RESIDUE ATP A 1 source : AC5 10) chain A residue 464 type sequence K description BINDING SITE FOR RESIDUE ATP A 1 source : AC5 11) chain A residue 465 type sequence T description BINDING SITE FOR RESIDUE ATP A 1 source : AC5 12) chain A residue 466 type sequence S description BINDING SITE FOR RESIDUE ATP A 1 source : AC5 13) chain A residue 493 type sequence Q description BINDING SITE FOR RESIDUE ATP A 1 source : AC5 14) chain A residue 541 type sequence L description BINDING SITE FOR RESIDUE ACY A 5 source : AC9 15) chain A residue 542 type sequence G description BINDING SITE FOR RESIDUE ACY A 5 source : AC9 16) chain A residue 545 type sequence G description BINDING SITE FOR RESIDUE ACY A 5 source : AC9 17) chain A residue 546 type sequence V description BINDING SITE FOR RESIDUE ACY A 5 source : AC9 18) chain A residue 547 type sequence T description BINDING SITE FOR RESIDUE ACY A 5 source : AC9 19) chain A residue 532 type sequence K description BINDING SITE FOR RESIDUE ACY A 10 source : BC5 20) chain A residue 549 type sequence S description BINDING SITE FOR RESIDUE ACY A 10 source : BC5 21) chain A residue 552 type sequence Q description BINDING SITE FOR RESIDUE ACY A 10 source : BC5 22) chain A residue 548-562 type prosite sequence LSGGQRARISLARAV description ABC_TRANSPORTER_1 ABC transporters family signature. LSGGQRARISLARAV source prosite : PS00211 23) chain A residue 401 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P13569 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 458 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00434, ECO:0007744|PDB:1Q3H, ECO:0007744|PDB:1R0X, ECO:0007744|PDB:1R0Z, ECO:0007744|PDB:1R10, ECO:0007744|PDB:1XF9, ECO:0007744|PDB:1XFA, ECO:0007744|PDB:3SI7 source Swiss-Prot : SWS_FT_FI2 25) chain A residue 493 type BINDING sequence Q description BINDING => ECO:0007744|PDB:1Q3H, ECO:0007744|PDB:1R0X, ECO:0007744|PDB:1R0Z, ECO:0007744|PDB:1XFA source Swiss-Prot : SWS_FT_FI3 26) chain A residue 549 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P13569 source Swiss-Prot : SWS_FT_FI4 27) chain A residue 660 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P13569 source Swiss-Prot : SWS_FT_FI4 28) chain A residue 670 type MOD_RES sequence S description Phosphoserine; by PKA => ECO:0000250|UniProtKB:P13569 source Swiss-Prot : SWS_FT_FI5 29) chain A residue 524 type LIPID sequence C description S-palmitoyl cysteine => ECO:0000250|UniProtKB:P13569 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links