eF-site ID 1r0s-AB
PDB Code 1r0s
Chain A, B

click to enlarge
Title Crystal structure of ADP-ribosyl cyclase Glu179Ala mutant
Classification HYDROLASE
Compound ADP-ribosyl cyclase
Source Aplysia californica (California sea hare) (NADA_APLCA)
Sequence A:  IVPTRELENVFLGRCKDYEITRYLDILPRVRSDCSALWKD
FFKAFSFKNPCDLDLGSYKDFFTSAQQQLPKNKVMFWSGV
YDEAHDYANTGRKYITLEDTLPGYMLNSLVWCGQRANPGF
NEKVCPDFKTCPVQARESFWGMASSSYAHSAEGEVTYMVD
GSNPKVPAYRPDSFFGKYALPNLTNKVTRVKVIVLHRLGE
KIIEKCGAGSLLDLEKLVKAKHFAFDCVENPRAVLFLLCS
DNPNARECRLA
B:  IVPTRELENVFLGRCKDYEITRYLDILPRVRSDCSALWKD
FFKAFSFKNPCDLDLGSYKDFFTSAQQQLPKNKVMFWSGV
YDEAHDYANTGRKYITLEDTLPGYMLNSLVWCGQRANPGF
NEKVCPDFKTCPVQARESFWGMASSSYAHSAEGEVTYMVD
GSNPKVPAYRPDSFFGKYALPNLTNKVTRVKVIVLHRLGE
KIIEKCGAGSLLDLEKLVKAKHFAFDCVENPRAVLFLLCS
DNPNARECRLA
Description (1)  ADP-ribosyl cyclase (E.C.3.2.2.5)


Functional site

1) chain A
residue 98
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1r16
source CSA : CSA1

2) chain A
residue 179
type catalytic
ligand
sequence A
description Annotated By Reference To The Literature 1r16
source CSA : CSA1

3) chain B
residue 98
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1r16
source CSA : CSA2

4) chain B
residue 179
type catalytic
ligand
sequence A
description Annotated By Reference To The Literature 1r16
source CSA : CSA2


Display surface

Download
Links