eF-site ID 1r0o-AB PDB Code 1r0o Chain A, B click to enlarge Title Crystal Structure of the Heterodimeric Ecdysone Receptor DNA-binding Complex Classification Transcription/DNA Compound Ecdysone Response Element Source Drosophila melanogaster (Fruit fly) (1R0O) Sequence A:  HLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYACR ENRNCIIDKRQRNRCQYCRYQKCLTCGMKREAVQEE B:  EELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCC KFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPEN Description Functional site 1) chain B residue 7 type sequence C description BINDING SITE FOR RESIDUE ZN B 350 source : AC1 2) chain B residue 10 type sequence C description BINDING SITE FOR RESIDUE ZN B 350 source : AC1 3) chain B residue 24 type sequence C description BINDING SITE FOR RESIDUE ZN B 350 source : AC1 4) chain B residue 27 type sequence C description BINDING SITE FOR RESIDUE ZN B 350 source : AC1 5) chain A residue 7 type sequence C description BINDING SITE FOR RESIDUE ZN A 351 source : AC2 6) chain A residue 10 type sequence C description BINDING SITE FOR RESIDUE ZN A 351 source : AC2 7) chain A residue 24 type sequence C description BINDING SITE FOR RESIDUE ZN A 351 source : AC2 8) chain A residue 27 type sequence C description BINDING SITE FOR RESIDUE ZN A 351 source : AC2 9) chain B residue 43 type sequence C description BINDING SITE FOR RESIDUE ZN B 352 source : AC3 10) chain B residue 49 type sequence C description BINDING SITE FOR RESIDUE ZN B 352 source : AC3 11) chain B residue 59 type sequence C description BINDING SITE FOR RESIDUE ZN B 352 source : AC3 12) chain B residue 62 type sequence C description BINDING SITE FOR RESIDUE ZN B 352 source : AC3 13) chain A residue 43 type sequence C description BINDING SITE FOR RESIDUE ZN A 353 source : AC4 14) chain A residue 49 type sequence C description BINDING SITE FOR RESIDUE ZN A 353 source : AC4 15) chain A residue 59 type sequence C description BINDING SITE FOR RESIDUE ZN A 353 source : AC4 16) chain A residue 62 type sequence C description BINDING SITE FOR RESIDUE ZN A 353 source : AC4 17) chain B residue 7-79 type DNA_BIND sequence CLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFG RACEMDMYMRRKCQECRLKKCLAVGMRPECVVP description Nuclear receptor => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI1 18) chain B residue 7-27 type ZN_FING sequence CLVCGDRASGYHYNALTCEGC description NR C4-type => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI2 19) chain B residue 43-67 type ZN_FING sequence CKFGRACEMDMYMRRKCQECRLKKC description NR C4-type => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI2 20) chain B residue 7-33 type prosite sequence CLVCGDRASGYHYNALTCEGCKGFFRR description NUCLEAR_REC_DBD_1 Nuclear hormones receptors DNA-binding region signature. ClvCg.Drasgy.HYnaltCegCkgFFrR source prosite : PS00031 21) chain A residue 7-33 type prosite sequence CSICGDRASGKHYGVYSCEGCKGFFKR description NUCLEAR_REC_DBD_1 Nuclear hormones receptors DNA-binding region signature. ClvCg.Drasgy.HYnaltCegCkgFFrR source prosite : PS00031

Display surface Download Links