eF-site ID 1r0o-A PDB Code 1r0o Chain A click to enlarge Title Crystal Structure of the Heterodimeric Ecdysone Receptor DNA-binding Complex Classification Transcription/DNA Compound Ecdysone Response Element Source null (1R0O) Sequence A:  HLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYACR ENRNCIIDKRQRNRCQYCRYQKCLTCGMKREAVQEE Description Functional site 1) chain A residue 7 type sequence C description BINDING SITE FOR RESIDUE ZN A 351 source : AC2 2) chain A residue 10 type sequence C description BINDING SITE FOR RESIDUE ZN A 351 source : AC2 3) chain A residue 24 type sequence C description BINDING SITE FOR RESIDUE ZN A 351 source : AC2 4) chain A residue 27 type sequence C description BINDING SITE FOR RESIDUE ZN A 351 source : AC2 5) chain A residue 43 type sequence C description BINDING SITE FOR RESIDUE ZN A 353 source : AC4 6) chain A residue 49 type sequence C description BINDING SITE FOR RESIDUE ZN A 353 source : AC4 7) chain A residue 59 type sequence C description BINDING SITE FOR RESIDUE ZN A 353 source : AC4 8) chain A residue 62 type sequence C description BINDING SITE FOR RESIDUE ZN A 353 source : AC4 9) chain A residue 7-33 type prosite sequence CSICGDRASGKHYGVYSCEGCKGFFKR description NUCLEAR_REC_DBD_1 Nuclear hormones receptors DNA-binding region signature. CsiCg.Drasgk.HYgvysCegCkgFFkR source prosite : PS00031

Display surface Download Links