eF-site ID 1r0n-B PDB Code 1r0n Chain B click to enlarge Title Crystal Structure of Heterodimeric Ecdsyone receptor DNA binding complex Classification Transcription/DNA Compound Ecdsyone Response Element Source null (1R0N) Sequence B:  ELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCK FGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCA MKRREK Description Functional site 1) chain B residue 201 type sequence C description BINDING SITE FOR RESIDUE ZN B 150 source : AC1 2) chain B residue 204 type sequence C description BINDING SITE FOR RESIDUE ZN B 150 source : AC1 3) chain B residue 218 type sequence C description BINDING SITE FOR RESIDUE ZN B 150 source : AC1 4) chain B residue 221 type sequence C description BINDING SITE FOR RESIDUE ZN B 150 source : AC1 5) chain B residue 237 type sequence C description BINDING SITE FOR RESIDUE ZN B 152 source : AC3 6) chain B residue 243 type sequence C description BINDING SITE FOR RESIDUE ZN B 152 source : AC3 7) chain B residue 253 type sequence C description BINDING SITE FOR RESIDUE ZN B 152 source : AC3 8) chain B residue 256 type sequence C description BINDING SITE FOR RESIDUE ZN B 152 source : AC3 9) chain B residue 201-273 type DNA_BIND sequence CLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFG RACEMDMYMRRKCQECRLKKCLAVGMRPECVVP description Nuclear receptor => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI1 10) chain B residue 201-221 type ZN_FING sequence CLVCGDRASGYHYNALTCEGC description NR C4-type => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI2 11) chain B residue 237-261 type ZN_FING sequence CKFGRACEMDMYMRRKCQECRLKKC description NR C4-type => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI2 12) chain B residue 201-227 type prosite sequence CLVCGDRASGYHYNALTCEGCKGFFRR description NUCLEAR_REC_DBD_1 Nuclear hormones receptors DNA-binding region signature. CaiCg.Drssgk.HYgvysCegCkgFFkR source prosite : PS00031

Display surface Download Links