eF-site ID 1r0n-A PDB Code 1r0n Chain A click to enlarge Title Crystal Structure of Heterodimeric Ecdsyone receptor DNA binding complex Classification Transcription/DNA Compound Ecdsyone Response Element Source null (1R0N) Sequence A:  HICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCR DNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQAAAA Description Functional site 1) chain A residue 101 type sequence C description BINDING SITE FOR RESIDUE ZN A 177 source : AC2 2) chain A residue 104 type sequence C description BINDING SITE FOR RESIDUE ZN A 177 source : AC2 3) chain A residue 118 type sequence C description BINDING SITE FOR RESIDUE ZN A 177 source : AC2 4) chain A residue 121 type sequence C description BINDING SITE FOR RESIDUE ZN A 177 source : AC2 5) chain A residue 137 type sequence C description BINDING SITE FOR RESIDUE ZN A 178 source : AC4 6) chain A residue 143 type sequence C description BINDING SITE FOR RESIDUE ZN A 178 source : AC4 7) chain A residue 153 type sequence C description BINDING SITE FOR RESIDUE ZN A 178 source : AC4 8) chain A residue 156 type sequence C description BINDING SITE FOR RESIDUE ZN A 178 source : AC4 9) chain A residue 101 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10669605, ECO:0007744|PDB:1BY4 source Swiss-Prot : SWS_FT_FI3 10) chain A residue 104 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10669605, ECO:0007744|PDB:1BY4 source Swiss-Prot : SWS_FT_FI3 11) chain A residue 118 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10669605, ECO:0007744|PDB:1BY4 source Swiss-Prot : SWS_FT_FI3 12) chain A residue 121 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10669605, ECO:0007744|PDB:1BY4 source Swiss-Prot : SWS_FT_FI3 13) chain A residue 137 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10669605, ECO:0007744|PDB:1BY4 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 143 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10669605, ECO:0007744|PDB:1BY4 source Swiss-Prot : SWS_FT_FI3 15) chain A residue 153 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10669605, ECO:0007744|PDB:1BY4 source Swiss-Prot : SWS_FT_FI3 16) chain A residue 156 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10669605, ECO:0007744|PDB:1BY4 source Swiss-Prot : SWS_FT_FI3 17) chain A residue 101-127 type prosite sequence CAICGDRSSGKHYGVYSCEGCKGFFKR description NUCLEAR_REC_DBD_1 Nuclear hormones receptors DNA-binding region signature. CaiCg.Drssgk.HYgvysCegCkgFFkR source prosite : PS00031 18) chain A residue 111 type MOD_RES sequence K description N6-acetyllysine; by EP300 => ECO:0000269|PubMed:17761950 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links