eF-site ID 1qtx-A PDB Code 1qtx Chain A click to enlarge Title THE 1.65 ANGSTROM STRUCTURE OF CALMODULIN RS20 PEPTIDE COMPLEX Classification SIGNALING PROTEIN Compound PROTEIN (CALMODULIN) Source Gallus gallus (Chicken) (MYLK_CHICK) Sequence A:  ADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG QNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTD SEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEE VDEMIREADVDGDGQVNYEEFVQVMMAK Description Functional site 1) chain A residue 20 type sequence D description BINDING SITE FOR RESIDUE CA A 151 source : AC1 2) chain A residue 22 type sequence D description BINDING SITE FOR RESIDUE CA A 151 source : AC1 3) chain A residue 24 type sequence D description BINDING SITE FOR RESIDUE CA A 151 source : AC1 4) chain A residue 26 type sequence T description BINDING SITE FOR RESIDUE CA A 151 source : AC1 5) chain A residue 31 type sequence E description BINDING SITE FOR RESIDUE CA A 151 source : AC1 6) chain A residue 56 type sequence D description BINDING SITE FOR RESIDUE CA A 152 source : AC2 7) chain A residue 58 type sequence D description BINDING SITE FOR RESIDUE CA A 152 source : AC2 8) chain A residue 60 type sequence N description BINDING SITE FOR RESIDUE CA A 152 source : AC2 9) chain A residue 62 type sequence T description BINDING SITE FOR RESIDUE CA A 152 source : AC2 10) chain A residue 67 type sequence E description BINDING SITE FOR RESIDUE CA A 152 source : AC2 11) chain A residue 93 type sequence D description BINDING SITE FOR RESIDUE CA A 153 source : AC3 12) chain A residue 95 type sequence D description BINDING SITE FOR RESIDUE CA A 153 source : AC3 13) chain A residue 97 type sequence N description BINDING SITE FOR RESIDUE CA A 153 source : AC3 14) chain A residue 99 type sequence F description BINDING SITE FOR RESIDUE CA A 153 source : AC3 15) chain A residue 104 type sequence E description BINDING SITE FOR RESIDUE CA A 153 source : AC3 16) chain A residue 129 type sequence D description BINDING SITE FOR RESIDUE CA A 154 source : AC4 17) chain A residue 131 type sequence D description BINDING SITE FOR RESIDUE CA A 154 source : AC4 18) chain A residue 133 type sequence D description BINDING SITE FOR RESIDUE CA A 154 source : AC4 19) chain A residue 135 type sequence Q description BINDING SITE FOR RESIDUE CA A 154 source : AC4 20) chain A residue 140 type sequence E description BINDING SITE FOR RESIDUE CA A 154 source : AC4 21) chain A residue 20-32 type prosite sequence DKDGDGTITTKEL description EF_HAND_1 EF-hand calcium-binding domain. DKDGDGTITtkEL source prosite : PS00018 22) chain A residue 56-68 type prosite sequence DADGNGTIDFPEF description EF_HAND_1 EF-hand calcium-binding domain. DKDGDGTITtkEL source prosite : PS00018 23) chain A residue 93-105 type prosite sequence DKDGNGFISAAEL description EF_HAND_1 EF-hand calcium-binding domain. DKDGDGTITtkEL source prosite : PS00018 24) chain A residue 129-141 type prosite sequence DVDGDGQVNYEEF description EF_HAND_1 EF-hand calcium-binding domain. DKDGDGTITtkEL source prosite : PS00018

Display surface Download Links